![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Phvul.007G140300.2 | ||||||||
| Common Name | PHAVU_007G140300g | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 179aa MW: 20201.9 Da PI: 10.3521 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 173.7 | 5.3e-54 | 32 | 159 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp..kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89
l+pGfrFhPtdeelv +yLk+kv+gk++++ ++i+evdiy++ePwdL +++k++++ewyfFs dkky +g r nrat++gyWkatg+d
Phvul.007G140300.2 32 LAPGFRFHPTDEELVIYYLKRKVSGKSFRF-DAISEVDIYRSEPWDLAdkSRLKTRDQEWYFFSALDKKYGNGGRMNRATNKGYWKATGND 121
579**************************9.99**************75348899999********************************* PP
NAM 90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
++v++ ++++vglkktLvf++grap g++t+Wvmheyrl
Phvul.007G140300.2 122 RPVKH-DQRTVGLKKTLVFHSGRAPVGKRTNWVMHEYRL 159
*****.999****************************98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF101941 | 2.48E-57 | 25 | 164 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 53.409 | 32 | 178 | IPR003441 | NAC domain |
| Pfam | PF02365 | 1.4E-28 | 34 | 159 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0009555 | Biological Process | pollen development | ||||
| GO:0010228 | Biological Process | vegetative to reproductive phase transition of meristem | ||||
| GO:0005730 | Cellular Component | nucleolus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 179 aa Download sequence Send to blast |
MGRETVFLPA PPTTATTAVN PVAAPATPPT SLAPGFRFHP TDEELVIYYL KRKVSGKSFR 60 FDAISEVDIY RSEPWDLADK SRLKTRDQEW YFFSALDKKY GNGGRMNRAT NKGYWKATGN 120 DRPVKHDQRT VGLKKTLVFH SGRAPVGKRT NWVMHEYRLV DEELERAGTG SSQPQVRL* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 3swm_A | 2e-47 | 31 | 161 | 19 | 147 | NAC domain-containing protein 19 |
| 3swm_B | 2e-47 | 31 | 161 | 19 | 147 | NAC domain-containing protein 19 |
| 3swm_C | 2e-47 | 31 | 161 | 19 | 147 | NAC domain-containing protein 19 |
| 3swm_D | 2e-47 | 31 | 161 | 19 | 147 | NAC domain-containing protein 19 |
| 3swp_A | 2e-47 | 31 | 161 | 19 | 147 | NAC domain-containing protein 19 |
| 3swp_B | 2e-47 | 31 | 161 | 19 | 147 | NAC domain-containing protein 19 |
| 3swp_C | 2e-47 | 31 | 161 | 19 | 147 | NAC domain-containing protein 19 |
| 3swp_D | 2e-47 | 31 | 161 | 19 | 147 | NAC domain-containing protein 19 |
| 3ulx_A | 2e-47 | 31 | 159 | 14 | 140 | Stress-induced transcription factor NAC1 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional repressor that binds to the motif 5'-(C/T)A(C/A)G-3' in the promoter of target genes (PubMed:25578968). Binds also to the 5'-CTTGNNNNNCAAG-3' consensus sequence in chromatin (PubMed:26617990). Can bind to the mitochondrial dysfunction motif (MDM) present in the upstream regions of mitochondrial dysfunction stimulon (MDS) genes involved in mitochondrial retrograde regulation (MRR) (PubMed:24045019). Together with NAC051/NAC052 and JMJ14, regulates gene expression and flowering time by associating with the histone demethylase JMJ14, probably by the promotion of RNA-mediated gene silencing (PubMed:25578968, PubMed:26617990). {ECO:0000269|PubMed:24045019, ECO:0000269|PubMed:25578968, ECO:0000269|PubMed:26617990}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00612 | ChIP-seq | Transfer from AT3G10490 | Download |
| |||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Phvul.007G140300.2 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AP015041 | 1e-130 | AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_007144246.1 | 1e-131 | hypothetical protein PHAVU_007G140300g | ||||
| Swissprot | Q9SQX9 | 2e-80 | NAC50_ARATH; NAC domain containing protein 50 | ||||
| TrEMBL | V7BFB9 | 1e-129 | V7BFB9_PHAVU; Uncharacterized protein | ||||
| STRING | XP_007144247.1 | 1e-127 | (Phaseolus vulgaris) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G10480.1 | 1e-77 | NAC domain containing protein 50 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Phvul.007G140300.2 |
| Entrez Gene | 18625849 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




