![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Phvul.007G165100.1 | ||||||||
| Common Name | PHAVU_007G165100g | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 152aa MW: 17047 Da PI: 5.3391 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 175.5 | 5.1e-55 | 38 | 133 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyre 92
+eqdr+lPianv+rimk++lP nakisk+a+et+qecvsefisfvt+easdkc++ekrkt+ngdd++walatlGf+dy+eplk yl+kyre
Phvul.007G165100.1 38 KEQDRLLPIANVGRIMKQTLPPNAKISKEARETMQECVSEFISFVTGEASDKCHKEKRKTVNGDDICWALATLGFDDYAEPLKRYLHKYRE 128
89***************************************************************************************** PP
NF-YB 93 legek 97
lege+
Phvul.007G165100.1 129 LEGER 133
**997 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 2.5E-53 | 33 | 140 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 1.23E-40 | 40 | 141 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 5.9E-28 | 43 | 107 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 1.5E-20 | 71 | 89 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 74 | 90 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 1.5E-20 | 90 | 108 | No hit | No description |
| PRINTS | PR00615 | 1.5E-20 | 109 | 127 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 152 aa Download sequence Send to blast |
MGDNINIGKV LDREGFKYSF TSSTATASDT SEQDGVIKEQ DRLLPIANVG RIMKQTLPPN 60 AKISKEARET MQECVSEFIS FVTGEASDKC HKEKRKTVNG DDICWALATL GFDDYAEPLK 120 RYLHKYRELE GERANQNKGN SYENNNIANI Y* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4g91_B | 2e-45 | 37 | 128 | 1 | 92 | Transcription factor HapC (Eurofung) |
| 4g92_B | 2e-45 | 37 | 128 | 1 | 92 | Transcription factor HapC (Eurofung) |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Phvul.007G165100.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AP015041 | 0.0 | AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_007144547.1 | 1e-111 | hypothetical protein PHAVU_007G165100g | ||||
| Swissprot | O82248 | 5e-61 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
| TrEMBL | V7BJ21 | 1e-109 | V7BJ21_PHAVU; Uncharacterized protein | ||||
| STRING | XP_007144547.1 | 1e-110 | (Phaseolus vulgaris) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF805 | 32 | 131 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G47810.1 | 1e-62 | nuclear factor Y, subunit B5 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Phvul.007G165100.1 |
| Entrez Gene | 18626103 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




