![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Phvul.007G241200.1 | ||||||||
| Common Name | PHAVU_007G241200g | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 122aa MW: 14321.5 Da PI: 10.7967 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 44.2 | 4.4e-14 | 56 | 101 | 2 | 47 |
SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
Myb_DNA-binding 2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
++WT+eE+ ++++ k G+g+Wk I++ ++t+ q+ s+ qky
Phvul.007G241200.1 56 KPWTEEEHRYFLCGLKNVGKGNWKEISKNYVRTKTPTQVASHAQKY 101
58*****************************9*************9 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 15.674 | 50 | 106 | IPR017930 | Myb domain |
| SuperFamily | SSF46689 | 5.73E-17 | 52 | 106 | IPR009057 | Homeodomain-like |
| Gene3D | G3DSA:1.10.10.60 | 3.7E-10 | 54 | 100 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 1.1E-10 | 54 | 104 | IPR001005 | SANT/Myb domain |
| TIGRFAMs | TIGR01557 | 3.7E-16 | 54 | 104 | IPR006447 | Myb domain, plants |
| Pfam | PF00249 | 4.9E-12 | 56 | 101 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 3.67E-9 | 57 | 102 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 122 aa Download sequence Send to blast |
MTFNRNSEDC LRLFGVNIVA KKPVTAADAE KDLNGAKSYI FLQRRHAFHD KKNKGKPWTE 60 EEHRYFLCGL KNVGKGNWKE ISKNYVRTKT PTQVASHAQK YFLRMSAFET RKRRRSLFDI 120 PL |
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 110 | 114 | RKRRR |
| 2 | 110 | 115 | RKRRRS |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor involved in somatic embryogenesis. Acts as positive regulator of BHLH109. {ECO:0000269|PubMed:26973252}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Phvul.007G241200.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AP015041 | 1e-89 | AP015041.1 Vigna angularis var. angularis DNA, chromosome 8, almost complete sequence, cultivar: Shumari. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_007145462.1 | 2e-88 | hypothetical protein PHAVU_007G241200g, partial | ||||
| Swissprot | Q9FKF9 | 2e-28 | M5162_ARATH; Probable transcription factor At5g61620 | ||||
| TrEMBL | V7BLI5 | 5e-87 | V7BLI5_PHAVU; Uncharacterized protein (Fragment) | ||||
| STRING | XP_007145462.1 | 8e-88 | (Phaseolus vulgaris) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF16861 | 7 | 8 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G61620.1 | 9e-31 | MYB_related family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Phvul.007G241200.1 |
| Entrez Gene | 18626889 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




