![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Phvul.009G060900.1 | ||||||||
| Common Name | PHAVU_009G060900g | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
|
||||||||
| Family | bZIP | ||||||||
| Protein Properties | Length: 146aa MW: 16980 Da PI: 6.5259 | ||||||||
| Description | bZIP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | bZIP_1 | 45.8 | 1.4e-14 | 31 | 89 | 5 | 63 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
++ +rkq+NRe+ArrsR RK+ +e L++ v e+++eN++ ++++ ++++ k ++e+
Phvul.009G060900.1 31 RKNKRKQSNRESARRSRMRKRDHLEDLRKQVSEFTKENREILATIDMTTQHYLKIEAEN 89
689************************************************99988776 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00338 | 1.4E-15 | 27 | 91 | IPR004827 | Basic-leucine zipper domain |
| Gene3D | G3DSA:1.20.5.170 | 7.0E-11 | 28 | 81 | No hit | No description |
| PROSITE profile | PS50217 | 10.783 | 29 | 92 | IPR004827 | Basic-leucine zipper domain |
| SuperFamily | SSF57959 | 2.5E-11 | 31 | 85 | No hit | No description |
| Pfam | PF00170 | 1.6E-10 | 31 | 87 | IPR004827 | Basic-leucine zipper domain |
| CDD | cd14702 | 1.13E-14 | 32 | 82 | No hit | No description |
| PROSITE pattern | PS00036 | 0 | 34 | 49 | IPR004827 | Basic-leucine zipper domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 146 aa Download sequence Send to blast |
MASSSGNSSI STKIQSSGSE EDLQVLTMDE RKNKRKQSNR ESARRSRMRK RDHLEDLRKQ 60 VSEFTKENRE ILATIDMTTQ HYLKIEAENC VLRAQMGELD QRLQSLNDMI VDIMNTTTFY 120 ERDCYLTSTQ NFTNTLCLNQ PVFEW* |
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 43 | 51 | RRSRMRKRD |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that binds to the DNA G-box motif 5'-CACGTG-3' of MAN7 promoter. Involved in the positive regulation of seed germination through MAN7 gene activation. MAN7 is required for both, loosening of the micropylar endosperm, and rupture of the seed coat in germinating seeds. {ECO:0000269|PubMed:23461773}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Phvul.009G060900.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AP015035 | 1e-175 | AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_007136637.1 | 1e-104 | hypothetical protein PHAVU_009G060900g | ||||
| Swissprot | C0Z2L5 | 2e-36 | BZP44_ARATH; bZIP transcription factor 44 | ||||
| TrEMBL | V7AWN3 | 1e-103 | V7AWN3_PHAVU; Uncharacterized protein | ||||
| STRING | XP_007136637.1 | 1e-103 | (Phaseolus vulgaris) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF20148 | 4 | 5 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G75390.1 | 2e-22 | basic leucine-zipper 44 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Phvul.009G060900.1 |
| Entrez Gene | 18619293 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




