![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Phvul.009G080000.1 | ||||||||
| Common Name | PHAVU_009G080000g | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
|
||||||||
| Family | WRKY | ||||||||
| Protein Properties | Length: 159aa MW: 18054.8 Da PI: 4.9356 | ||||||||
| Description | WRKY family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | WRKY | 96 | 2.6e-30 | 97 | 155 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59
+dDg++WrKYG+K+vk+s++pr+YY+C+ gC+vkk ver+++dp++v++tY g+H+h+
Phvul.009G080000.1 97 MDDGFKWRKYGKKKVKNSPNPRNYYKCSVDGCSVKKTVEREKDDPRYVITTYVGTHTHP 155
59********************************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:2.20.25.80 | 2.7E-32 | 84 | 156 | IPR003657 | WRKY domain |
| SuperFamily | SSF118290 | 7.59E-28 | 90 | 156 | IPR003657 | WRKY domain |
| PROSITE profile | PS50811 | 28.966 | 92 | 157 | IPR003657 | WRKY domain |
| SMART | SM00774 | 3.3E-33 | 97 | 156 | IPR003657 | WRKY domain |
| Pfam | PF03106 | 1.0E-24 | 98 | 155 | IPR003657 | WRKY domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0009867 | Biological Process | jasmonic acid mediated signaling pathway | ||||
| GO:0050832 | Biological Process | defense response to fungus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 159 aa Download sequence Send to blast |
MSDNNPKPPD SPESDFSKQW PSELYEYLNL DDDQLACDEL DSFVSGHVLS PNTDQANEVG 60 DLVGSSSHHE EFSTNVDEKK EVRDRVAFKT KSEIEIMDDG FKWRKYGKKK VKNSPNPRNY 120 YKCSVDGCSV KKTVEREKDD PRYVITTYVG THTHPSNS* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1wj2_A | 8e-24 | 87 | 154 | 7 | 74 | Probable WRKY transcription factor 4 |
| 2lex_A | 8e-24 | 87 | 154 | 7 | 74 | Probable WRKY transcription factor 4 |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00531 | DAP | Transfer from AT5G26170 | Download |
| |||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Phvul.009G080000.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AP015035 | 7e-61 | AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_007136862.1 | 1e-115 | hypothetical protein PHAVU_009G080000g | ||||
| Swissprot | Q8VWQ5 | 3e-38 | WRK50_ARATH; Probable WRKY transcription factor 50 | ||||
| TrEMBL | V7AX97 | 1e-113 | V7AX97_PHAVU; Uncharacterized protein | ||||
| STRING | XP_007136862.1 | 1e-114 | (Phaseolus vulgaris) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF1120 | 34 | 110 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G26170.1 | 1e-40 | WRKY DNA-binding protein 50 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Phvul.009G080000.1 |
| Entrez Gene | 18619486 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




