PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Phvul.009G176700.1

Common Name

PHAVU_009G176700g

Organism

Phaseolus vulgaris

Taxonomic ID

3885

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus

Family

TALE

Protein Properties

Length: 128aa MW: 14968.1 Da PI: 10.0823

Description

TALE family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Phvul.009G176700.1	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Homeobox	30.4	6.7e-10	72	106	21	55
HSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS Homeobox 21 knrypsaeereeLAkklgLterqVkvWFqNrRake 55 k +yp+ +++ LA+++gL+++qV +WF N+R ++ Phvul.009G176700.1 72 KWPYPTDADKVALAEWTGLDQKQVNNWFINQRKRH 106 469*****************************885 PP
2	ELK	27	1e-09	26	47	1	22
ELK 1 ELKhqLlrKYsgyLgsLkqEFs 22 ELK+ Ll Ysgy+ +Lk+EFs Phvul.009G176700.1 26 ELKDNLLSRYSGYITNLKHEFS 47 9********************8 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Pfam	PF03789	6.1E-10	26	47	IPR005539	ELK domain
SMART	SM01188	5.3E-6	26	47	IPR005539	ELK domain
PROSITE profile	PS51213	9.865	26	46	IPR005539	ELK domain
PROSITE profile	PS50071	12.179	46	109	IPR001356	Homeobox domain
SMART	SM00389	6.3E-12	48	113	IPR001356	Homeobox domain
SuperFamily	SSF46689	1.33E-19	48	117	IPR009057	Homeodomain-like
Gene3D	G3DSA:1.10.10.60	4.5E-27	51	112	IPR009057	Homeodomain-like
CDD	cd00086	2.30E-11	62	110	No hit	No description
Pfam	PF05920	4.1E-16	66	105	IPR008422	Homeobox KN domain
PROSITE pattern	PS00027	0	84	107	IPR017970	Homeobox, conserved site

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0043565	Molecular Function	sequence-specific DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 128 aa Download sequence Send to blast
MGDVGGSSGK DSTKRIESKK TNEVQELKDN LLSRYSGYIT NLKHEFSRKK KKEKLPKEAK 60 KILLAWWNIH FKWPYPTDAD KVALAEWTGL DQKQVNNWFI NQRKRHWKPS EEMQVAILDG 120 LYEPLHE*

Nucleic Localization Signal ? help Back to Top

No.	Start	End	Sequence
1	47	52	RKKKKE
2	47	53	RKKKKEK

Functional Description ? help Back to Top
Source	Description
UniProt	May play a role in meristem function, and may be involved in maintaining cells in an undifferentiated, meristematic state, and its expression disappears at the same time the shoot apex undergoes the transition from vegetative to reproductive development (PubMed:11934861). Positive regulator of LATERAL ORGAN BOUNDARIES (LOB) (PubMed:11934861). Probably binds to the DNA sequence 5'-TGAC-3' (PubMed:11934861). Able to traffic from the L1 to the L2/L3 layers of the meristem, presumably through plasmodesmata (PubMed:12900451). {ECO:0000269\|PubMed:11934861, ECO:0000269\|PubMed:12900451, ECO:0000269\|PubMed:7866029}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Phvul.009G176700.1

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Negatively regulated by ASYMMETRIC LEAVES1 (AS1) and ASYMMETRIC LEAVES2 (AS2).

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AP015035	5e-89	AP015035.1 Vigna angularis var. angularis DNA, chromosome 2, almost complete sequence, cultivar: Shumari.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_007138055.1	1e-89	hypothetical protein PHAVU_009G176700g
Swissprot	P46639	9e-41	KNAT1_ARATH; Homeobox protein knotted-1-like 1
TrEMBL	V7AWU4	3e-88	V7AWU4_PHAVU; Uncharacterized protein
STRING	XP_007138055.1	5e-89	(Phaseolus vulgaris)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF620	34	125

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G08150.1	6e-36	KNOTTED-like from Arabidopsis thaliana

Link Out ? help Back to Top
Phytozome	Phvul.009G176700.1
Entrez Gene	18620488

Publications ? help Back to Top
dela Paz JS, et al. Chromosome fragile sites in Arabidopsis harbor matrix attachment regions that may be associated with ancestral chromosome rearrangement events. PLoS Genet., 2012. 8(12): p. e1003136 [PMID:23284301] Liu C, et al. Phosphatidylserine synthase 1 is required for inflorescence meristem and organ development in Arabidopsis. J Integr Plant Biol, 2013. 55(8): p. 682-95 [PMID:23931744] Liu B, et al. NEVERSHED and INFLORESCENCE DEFICIENT IN ABSCISSION are differentially required for cell expansion and cell separation during floral organ abscission in Arabidopsis thaliana. J. Exp. Bot., 2013. 64(17): p. 5345-57 [PMID:23963677] Simonini S,Kater MM Class I BASIC PENTACYSTEINE factors regulate HOMEOBOX genes involved in meristem size maintenance. J. Exp. Bot., 2014. 65(6): p. 1455-65 [PMID:24482368] Scofield S,Dewitte W,Murray JA STM sustains stem cell function in the Arabidopsis shoot apical meristem and controls KNOX gene expression independently of the transcriptional repressor AS1. Plant Signal Behav, 2018. [PMID:24776954] Lee JE,Lampugnani ER,Bacic A,Golz JF SEUSS and SEUSS-LIKE 2 coordinate auxin distribution and KNOXI activity during embryogenesis. Plant J., 2014. 80(1): p. 122-35 [PMID:25060324] Rast-Somssich MI, et al. Alternate wiring of a KNOXI genetic network underlies differences in leaf development of A. thaliana and C. hirsuta. Genes Dev., 2015. 29(22): p. 2391-404 [PMID:26588991] Duplat-Bermúdez L,Ruiz-Medrano R,Landsman D,Mariño-Ramírez L,Xoconostle-Cázares B Transcriptomic analysis of Arabidopsis overexpressing flowering locus T driven by a meristem-specific promoter that induces early flowering. Gene, 2016. 587(2): p. 120-31 [PMID:27154816] Li Z, et al. Transcription factors AS1 and AS2 interact with LHP1 to repress KNOX genes in Arabidopsis. J Integr Plant Biol, 2016. 58(12): p. 959-970 [PMID:27273574] Lozano-Sotomayor P, et al. Altered expression of the bZIP transcription factor DRINK ME affects growth and reproductive development in Arabidopsis thaliana. Plant J., 2016. 88(3): p. 437-451 [PMID:27402171] Frangedakis E,Saint-Marcoux D,Moody LA,Rabbinowitsch E,Langdale JA Nonreciprocal complementation of KNOX gene function in land plants. New Phytol., 2017. 216(2): p. 591-604 [PMID:27886385] Woerlen N, et al. Repression of BLADE-ON-PETIOLE genes by KNOX homeodomain protein BREVIPEDICELLUS is essential for differentiation of secondary xylem in Arabidopsis root. Planta, 2017. 245(6): p. 1079-1090 [PMID:28204875] Douglas SJ,Li B,Kliebenstein DJ,Nambara E,Riggs CD A novel Filamentous Flower mutant suppresses brevipedicellus developmental defects and modulates glucosinolate and auxin levels. PLoS ONE, 2017. 12(5): p. e0177045 [PMID:28493925] Wang X, et al. Overexpressed BRH1, a RING finger gene, alters rosette leaf shape in Arabidopsis thaliana. Sci China Life Sci, 2018. 61(1): p. 79-87 [PMID:28887625] Simonini S,Stephenson P,Østergaard L A molecular framework controlling style morphology in Brassicaceae. Development, 2018. [PMID:29440299] Felipo-Benavent A, et al. Regulation of xylem fiber differentiation by gibberellins through DELLA-KNAT1 interaction. Development, 2019. [PMID:30389856]