![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Phvul.009G203400.1 | ||||||||
| Common Name | PHAVU_009G203400g | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
|
||||||||
| Family | MIKC_MADS | ||||||||
| Protein Properties | Length: 248aa MW: 28221.1 Da PI: 9.556 | ||||||||
| Description | MIKC_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 96.8 | 9e-31 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
krienk+nrqvtfskRr g+lKKA+E+SvLCdaeva+i+fs++gkl+eyss
Phvul.009G203400.1 9 KRIENKINRQVTFSKRRSGLLKKAHEISVLCDAEVALIVFSTKGKLFEYSS 59
79***********************************************96 PP
| |||||||
| 2 | K-box | 105.6 | 6.2e-35 | 77 | 174 | 3 | 100 |
K-box 3 kssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenka 93
+++ + ++ ++e+++ e+akLk+++e Lq++qR+++G+dL+ Ls+keLq+Le+qL+++lk+iRs+Kn+l++e+i+el kk k+lqe+n++
Phvul.009G203400.1 77 ERQLVVSDQPQSENWTLEHAKLKARLEVLQKNQRNFMGQDLDGLSIKELQNLEHQLDSALKHIRSRKNQLMYESISELNKKDKALQEQNNT 167
566666788899******************************************************************************* PP
K-box 94 Lrkklee 100
L kk++e
Phvul.009G203400.1 168 LAKKIKE 174
****987 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 32.24 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 3.7E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 2.96E-43 | 2 | 79 | No hit | No description |
| SuperFamily | SSF55455 | 1.57E-34 | 2 | 92 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.1E-31 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 2.5E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.1E-31 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 1.1E-31 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF01486 | 4.0E-29 | 83 | 172 | IPR002487 | Transcription factor, K-box |
| PROSITE profile | PS51297 | 16.843 | 88 | 178 | IPR002487 | Transcription factor, K-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0010077 | Biological Process | maintenance of inflorescence meristem identity | ||||
| GO:0010154 | Biological Process | fruit development | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 248 aa Download sequence Send to blast |
MGRGRVQLKR IENKINRQVT FSKRRSGLLK KAHEISVLCD AEVALIVFST KGKLFEYSSD 60 PCMERILERY ERYSYAERQL VVSDQPQSEN WTLEHAKLKA RLEVLQKNQR NFMGQDLDGL 120 SIKELQNLEH QLDSALKHIR SRKNQLMYES ISELNKKDKA LQEQNNTLAK KIKEKEKALA 180 AQQAQFERQA DEMDLASSVL VPQPLETSNI RGSSQVIGDG GDNEGSATTP SRVNAILPPW 240 MLRPTNE* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1tqe_P | 2e-22 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
| 1tqe_Q | 2e-22 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
| 1tqe_R | 2e-22 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
| 1tqe_S | 2e-22 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
| 6byy_A | 2e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
| 6byy_B | 2e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
| 6byy_C | 2e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
| 6byy_D | 2e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
| 6bz1_A | 2e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
| 6bz1_B | 2e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
| 6bz1_C | 2e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
| 6bz1_D | 2e-22 | 1 | 74 | 1 | 73 | MEF2 CHIMERA |
| 6c9l_A | 2e-22 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
| 6c9l_B | 2e-22 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
| 6c9l_C | 2e-22 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
| 6c9l_D | 2e-22 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
| 6c9l_E | 2e-22 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
| 6c9l_F | 2e-22 | 1 | 74 | 1 | 73 | Myocyte-specific enhancer factor 2B |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor that promotes early floral meristem identity in synergy with APETALA1 and CAULIFLOWER. Is required subsequently for the transition of an inflorescence meristem into a floral meristem (PubMed:28586421). Seems to be partially redundant to the function of APETALA1 and CAULIFLOWER in the up-regulation of LEAFY. Is also required for normal pattern of cell division, expansion and differentiation during morphogenesis of the silique (PubMed:28586421). Probably not required for fruit elongation but instead is required to prevent ectopic activity of IND. Represses SAUR10 expression in stems and inflorescence branches (PubMed:28586421). {ECO:0000269|PubMed:10648231, ECO:0000269|PubMed:15035986, ECO:0000269|PubMed:28586421, ECO:0000269|PubMed:9502732}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Phvul.009G203400.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Dramatically up-regulated upon the transition from vegetative to reproductive development. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | EU287456 | 0.0 | EU287456.1 Glycine max MADS box protein AP1a (AP1a) mRNA, complete cds. | |||
| GenBank | KF831241 | 0.0 | KF831241.1 Glycine max FULa mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_007138377.1 | 0.0 | hypothetical protein PHAVU_009G203400g | ||||
| Swissprot | Q38876 | 1e-117 | AGL8_ARATH; Agamous-like MADS-box protein AGL8 | ||||
| TrEMBL | V7B1N1 | 0.0 | V7B1N1_PHAVU; Uncharacterized protein | ||||
| STRING | XP_007138377.1 | 0.0 | (Phaseolus vulgaris) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF588 | 32 | 119 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G60910.1 | 1e-110 | AGAMOUS-like 8 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Phvul.009G203400.1 |
| Entrez Gene | 18620762 |




