![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Potri.001G345700.1 | ||||||||
| Common Name | POPTR_0001s35280g | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
| Family | LBD | ||||||||
| Protein Properties | Length: 162aa MW: 17816.1 Da PI: 7.2685 | ||||||||
| Description | LBD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | DUF260 | 142.1 | 1.7e-44 | 10 | 108 | 1 | 99 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91
+CaaCk+lrrkC +dC++apyfp e+p+kfanvhk+FGasnv+kll+++ +++reda++sl+yeAear++dPvyG+vg i+ lq+q+ +l+
Potri.001G345700.1 10 PCAACKFLRRKCMPDCIFAPYFPPEEPQKFANVHKIFGASNVSKLLNEVLPHQREDAVNSLAYEAEARMKDPVYGCVGAISVLQRQVIRLQ 100
7****************************************************************************************** PP
DUF260 92 aelallke 99
+el+++++
Potri.001G345700.1 101 KELDATNA 108
***99876 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50891 | 27.673 | 9 | 110 | IPR004883 | Lateral organ boundaries, LOB |
| Pfam | PF03195 | 7.3E-44 | 10 | 107 | IPR004883 | Lateral organ boundaries, LOB |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 162 aa Download sequence Send to blast |
MASSSYSNSP CAACKFLRRK CMPDCIFAPY FPPEEPQKFA NVHKIFGASN VSKLLNEVLP 60 HQREDAVNSL AYEAEARMKD PVYGCVGAIS VLQRQVIRLQ KELDATNADL IRYACNEMPA 120 ANPQFGRRMG HGGVSYDQSS GIYYPSPWNN DTCGERGDGS I* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5ly0_A | 3e-67 | 7 | 118 | 8 | 119 | LOB family transfactor Ramosa2.1 |
| 5ly0_B | 3e-67 | 7 | 118 | 8 | 119 | LOB family transfactor Ramosa2.1 |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in a band of cells at the adaxial base of all lateral organs formed from the shoot apical meristem and at the base of lateral roots. {ECO:0000269|PubMed:12068116}. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in young shoots, roots, stems, leaves and flowers. {ECO:0000269|PubMed:12068116}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Not known; ectopic expression of LOB leads to alterations in the size and shape of leaves and floral organs and causes male and female sterility. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Potri.001G345700.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Positively regulated within the shoot apex by both ASYMMETRIC LEAVES 1 (AS1) and ASYMMETRIC LEAVES 2 (AS2/LBD6) and by KNAT1. {ECO:0000269|PubMed:11934861}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002300051.1 | 1e-119 | LOB domain-containing protein 25 | ||||
| Refseq | XP_024467046.1 | 1e-119 | LOB domain-containing protein 25 | ||||
| Refseq | XP_024467049.1 | 1e-119 | LOB domain-containing protein 25 | ||||
| Refseq | XP_024467052.1 | 1e-119 | LOB domain-containing protein 25 | ||||
| Refseq | XP_024467061.1 | 1e-119 | LOB domain-containing protein 25 | ||||
| Refseq | XP_024467064.1 | 1e-119 | LOB domain-containing protein 25 | ||||
| Refseq | XP_024467066.1 | 1e-119 | LOB domain-containing protein 25 | ||||
| Refseq | XP_024467071.1 | 1e-119 | LOB domain-containing protein 25 | ||||
| Swissprot | Q8L8Q3 | 2e-68 | LBD25_ARATH; LOB domain-containing protein 25 | ||||
| Swissprot | Q9FML4 | 4e-68 | LOB_ARATH; Protein LATERAL ORGAN BOUNDARIES | ||||
| TrEMBL | B9GI56 | 1e-118 | B9GI56_POPTR; Uncharacterized protein | ||||
| STRING | POPTR_0001s35280.1 | 1e-118 | (Populus trichocarpa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF1091 | 34 | 112 | Representative plant | OGRP60 | 16 | 318 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G27650.1 | 6e-71 | LOB domain-containing protein 25 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Potri.001G345700.1 |
| Entrez Gene | 7487871 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




