![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Potri.001G367500.1 | ||||||||
| Common Name | POPTR_0001s37620g | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 168aa MW: 18193.2 Da PI: 4.756 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 181.3 | 8.4e-57 | 23 | 118 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyre 92
re drflP+anvsrimkk+lPanakisk+aketvqecvsefisf+t+easdkcqrekrktingddllwa++tlGfe+yveplkvyl+++re
Potri.001G367500.1 23 REMDRFLPVANVSRIMKKALPANAKISKEAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFEEYVEPLKVYLQRFRE 113
799**************************************************************************************** PP
NF-YB 93 legek 97
+egek
Potri.001G367500.1 114 MEGEK 118
***97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 5.5E-53 | 19 | 126 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 5.59E-41 | 26 | 152 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 2.2E-27 | 28 | 92 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 5.6E-21 | 56 | 74 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 59 | 75 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 5.6E-21 | 75 | 93 | No hit | No description |
| PRINTS | PR00615 | 5.6E-21 | 94 | 112 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 168 aa Download sequence Send to blast |
MADSDNDSGG QNPTSTNELF SPREMDRFLP VANVSRIMKK ALPANAKISK EAKETVQECV 60 SEFISFITGE ASDKCQREKR KTINGDDLLW AMTTLGFEEY VEPLKVYLQR FREMEGEKNT 120 VARDRDAPSN GSGPGAEGFS GYVYGSGAGF FNQMGGGGAG DSLGRLR* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4g91_B | 4e-46 | 23 | 113 | 2 | 92 | Transcription factor HapC (Eurofung) |
| 4g92_B | 4e-46 | 23 | 113 | 2 | 92 | Transcription factor HapC (Eurofung) |
| 5g49_A | 4e-46 | 20 | 113 | 4 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:11250072}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. {ECO:0000250}. | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Potri.001G367500.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC214028 | 0.0 | AC214028.1 Populus trichocarpa clone POP025-N21, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002298867.2 | 1e-121 | nuclear transcription factor Y subunit B-3 | ||||
| Swissprot | O23310 | 4e-69 | NFYB3_ARATH; Nuclear transcription factor Y subunit B-3 | ||||
| Swissprot | Q75IZ7 | 1e-68 | NFYB8_ORYSJ; Nuclear transcription factor Y subunit B-8 | ||||
| TrEMBL | A0A2K2C9J8 | 1e-120 | A0A2K2C9J8_POPTR; Uncharacterized protein | ||||
| STRING | POPTR_0001s37620.1 | 1e-120 | (Populus trichocarpa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF591 | 34 | 150 | Representative plant | OGRP168 | 17 | 170 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G14540.1 | 1e-71 | nuclear factor Y, subunit B3 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Potri.001G367500.1 |
| Entrez Gene | 7487543 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




