PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Potri.002G081000.3

Organism

Populus trichocarpa

Taxonomic ID

3694

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus

Family

NAC

Protein Properties

Length: 162aa MW: 18400.2 Da PI: 10.1723

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Potri.002G081000.3	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	171.6	2.4e-53	8	132	1	128
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 lppGfrFhPtdeelv +yL++k++++++ + +i+e+d+yk++PwdLp + +ekewyfF++rd+ky++g+r+nra+ +gyWkatg dk+ Potri.002G081000.3 8 LPPGFRFHPTDEELVLHYLCRKCSSQPIAV-PIIAEIDLYKFDPWDLPGIALYGEKEWYFFTPRDRKYPNGSRPNRAAGRGYWKATGADKP 97 79************************99.88***********65556899********************************* PP NAM 92 vlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 + + ++vg+kk Lvfy g+apkgekt+W+mheyrl Potri.002G081000.3 98 IGQ--PKTVGIKKALVFYAGKAPKGEKTNWIMHEYRL 132 98..778**************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	1.28E-58	4	137	IPR003441	NAC domain
PROSITE profile	PS51005	55.642	8	157	IPR003441	NAC domain
Pfam	PF02365	1.3E-28	9	132	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0009611	Biological Process	response to wounding
GO:0009788	Biological Process	negative regulation of abscisic acid-activated signaling pathway
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 162 aa Download sequence Send to blast
MTAATLELPP GFRFHPTDEE LVLHYLCRKC SSQPIAVPII AEIDLYKFDP WDLPGIALYG 60 EKEWYFFTPR DRKYPNGSRP NRAAGRGYWK ATGADKPIGQ PKTVGIKKAL VFYAGKAPKG 120 EKTNWIMHEY RLADVDRSAR KKNSLRVRSV ISAIRRDSFD I*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3ulx_A	5e-73	4	132	11	140	Stress-induced transcription factor NAC1
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Pth.5244	0.0	stem

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00121	DAP	Transfer from AT1G01720	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Potri.002G081000.3

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	CU227979	0.0	CU227979.1 Populus EST from severe drought-stressed leaves.
GenBank	CU228362	0.0	CU228362.1 Populus EST from severe drought-stressed leaves.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_002300972.1	1e-106	NAC domain-containing protein 2
Swissprot	Q39013	7e-93	NAC2_ARATH; NAC domain-containing protein 2
TrEMBL	B9GU14	1e-104	B9GU14_POPTR; Uncharacterized protein
STRING	POPTR_0002s08150.1	1e-105	(Populus trichocarpa)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G01720.1	3e-95	NAC family protein

Link Out ? help Back to Top
Phytozome	Potri.002G081000.3

Publications ? help Back to Top
Florentin A,Damri M,Grafi G Stress induces plant somatic cells to acquire some features of stem cells accompanied by selective chromatin reorganization. Dev. Dyn., 2013. 242(10): p. 1121-33 [PMID:23798027] Jensen MK, et al. ATAF1 transcription factor directly regulates abscisic acid biosynthetic gene NCED3 in Arabidopsis thaliana. FEBS Open Bio, 2013. 3: p. 321-7 [PMID:23951554] Wang YX Characterization of a novel Medicago sativa NAC transcription factor gene involved in response to drought stress. Mol. Biol. Rep., 2013. 40(11): p. 6451-8 [PMID:24057250] Yang X, et al. Overexpression of a Miscanthus lutarioriparius NAC gene MlNAC5 confers enhanced drought and cold tolerance in Arabidopsis. Plant Cell Rep., 2015. 34(6): p. 943-58 [PMID:25666276] Du Q,Wang H The role of HD-ZIP III transcription factors and miR165/166 in vascular development and secondary cell wall formation. Plant Signal Behav, 2015. 10(10): p. e1078955 [PMID:26340415] Takasaki H, et al. SNAC-As, stress-responsive NAC transcription factors, mediate ABA-inducible leaf senescence. Plant J., 2015. 84(6): p. 1114-23 [PMID:26518251] Liu Y,Sun J,Wu Y Arabidopsis ATAF1 enhances the tolerance to salt stress and ABA in transgenic rice. J. Plant Res., 2016. 129(5): p. 955-962 [PMID:27216423] Ghandchi FP,Caetano-Anolles G,Clough SJ,Ort DR Investigating the Control of Chlorophyll Degradation by Genomic Correlation Mining. PLoS ONE, 2016. 11(9): p. e0162327 [PMID:27618630] Zhao J,Missihoun TD,Bartels D The ATAF1 transcription factor is a key regulator of aldehyde dehydrogenase 7B4 (ALDH7B4) gene expression in Arabidopsis thaliana. Planta, 2018. 248(4): p. 1017-1027 [PMID:30027414]