PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Potri.003G014500.1

Organism

Populus trichocarpa

Taxonomic ID

3694

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus

Family

bZIP

Protein Properties

Length: 96aa MW: 11277.8 Da PI: 9.9595

Description

bZIP family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Potri.003G014500.1	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	bZIP_1	23.1	1.6e-07	3	39	17	53
HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 17 ArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelk 53 A+rsR RK+++++eLe+ v++L+a+ ++ ele + Potri.003G014500.1 3 AQRSRVRKLQYTAELERNVQALQAKGSEVSAELEFVN 39 89***********************999988887655 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.20.5.170	1.8E-5	3	43	No hit	No description
SuperFamily	SSF57959	6.96E-6	3	45	No hit	No description

Sequence ? help Back to Top
Protein Sequence Length: 96 aa Download sequence Send to blast
QFAQRSRVRK LQYTAELERN VQALQAKGSE VSAELEFVNQ QNLILSMENK ALKQRLENLA 60 QEQLIKYLEH EVLEREIGRL RALYQQQQQQ RSHSK*

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Pth.9623	1e-139	leaf

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in vascular tissues of leaves, stems and siliques, anthers, filaments, tapetum, mature pollen grains, pistil vascular tissues and papillar cells, and funiculi. {ECO:0000269\|PubMed:19449183}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator involved in the sporophytic control of cell wall patterning and gametophytic control of pollen development. May play a role in the control of metabolic pathways regulating cellular transport and lipid metabolism. {ECO:0000269\|PubMed:17719007, ECO:0000269\|PubMed:19449183}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Potri.003G014500.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	EF147888	1e-136	EF147888.1 Populus trichocarpa clone WS0125_L14 unknown mRNA.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_011007869.1	5e-49	PREDICTED: uncharacterized protein At4g06598-like
Swissprot	F4IN23	2e-21	BZP34_ARATH; Basic leucine zipper 34
TrEMBL	A0A2K2AZZ4	1e-57	A0A2K2AZZ4_POPTR; Uncharacterized protein (Fragment)
STRING	cassava4.1_009724m	2e-46	(Manihot esculenta)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF5123	26	37
Representative plant	OGRP126	17	181

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G58110.2	2e-42	bZIP family protein

Link Out ? help Back to Top
Phytozome	Potri.003G014500.1

Publications ? help Back to Top
Jiang J,Zhang Z,Cao J Pollen wall development: the associated enzymes and metabolic pathways. Plant Biol (Stuttg), 2013. 15(2): p. 249-63 [PMID:23252839] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Gibalová A, et al. Characterization of pollen-expressed bZIP protein interactions and the role of ATbZIP18 in the male gametophyte. Plant Reprod, 2017. 30(1): p. 1-17 [PMID:27896439] Ezer D, et al. The G-Box Transcriptional Regulatory Code in Arabidopsis. Plant Physiol., 2017. 175(2): p. 628-640 [PMID:28864470]