![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Potri.003G119700.6 | ||||||||
| Common Name | POPTR_0003s11960g | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 115aa MW: 13068.2 Da PI: 10.8756 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 98.2 | 3.4e-31 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
krien + rqvtfskRrng+lKKA+ELSvLCdaeva+i+fss+gklye+ss
Potri.003G119700.6 9 KRIENATSRQVTFSKRRNGLLKKAFELSVLCDAEVALIVFSSRGKLYEFSS 59
79***********************************************96 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 32.142 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 3.6E-41 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 3.79E-33 | 3 | 72 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 2.36E-42 | 3 | 71 | No hit | No description |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 4.7E-32 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 4.1E-27 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 4.7E-32 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 4.7E-32 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0010048 | Biological Process | vernalization response | ||||
| GO:0048510 | Biological Process | regulation of timing of transition from vegetative to reproductive phase | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 115 aa Download sequence Send to blast |
MVRGKTQMKR IENATSRQVT FSKRRNGLLK KAFELSVLCD AEVALIVFSS RGKLYEFSSS 60 SINRTIERYQ KRAKDVGISS KMVQDNIQPV KEDTFTLAKK IELLEVSKRF QGSF* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5f28_A | 4e-20 | 1 | 69 | 1 | 69 | MEF2C |
| 5f28_B | 4e-20 | 1 | 69 | 1 | 69 | MEF2C |
| 5f28_C | 4e-20 | 1 | 69 | 1 | 69 | MEF2C |
| 5f28_D | 4e-20 | 1 | 69 | 1 | 69 | MEF2C |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: During floral transition, expressed very early at the flanks of the inflorescence meristem in the anlagens upon the transition to flowering Subsequently, expression levels increase in the first and second stages of the floral meristem and at stage 3, expression is restricted to the L1 and L2 layers. Later on, expressed in the gynoecium and stamen primordia at stage 6. {ECO:0000269|PubMed:25636918}. | |||||
| Uniprot | TISSUE SPECIFICITY: Preferentially expressed in roots (PubMed:7549482). Expressed in lateral root cap, root epidermis, root endodermis, columella of the root meristematic region, the vascular cylinder in differentiated zones of the primary root and in emerged lateral root primordia (PubMed:24121311). Expressed in pollen (PubMed:12949148). {ECO:0000269|PubMed:12949148, ECO:0000269|PubMed:24121311, ECO:0000269|PubMed:7549482}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional activator that regulates root development by controlling meristem size and patterning of the root apical meristem. Regulates auxin transport and gradients in the root meristematic cells via direct regulation of the auxin efflux carrier PIN1 and PIN4 gene expression. Binds specifically to the CArG-box DNA sequences in the promoter regions of PIN1 and PIN4 genes (PubMed:24121311). Involved in the regulation of shoot apical meristem (SAM) cell identities and transitions. Promotes flowering transition and participates in flower meristem maintenance and determinacy. Positively regulates TFL1 and WUS expression. Binds directly to the TFL1 regulatory sequences (PubMed:25636918). {ECO:0000269|PubMed:24121311}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Potri.003G119700.6 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By auxin. {ECO:0000269|PubMed:24121311}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | DQ500880 | 1e-126 | DQ500880.1 Populus tomentosa MADS box transcription factor (MADS3) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_024452474.1 | 6e-72 | agamous-like MADS-box protein AGL19 isoform X1 | ||||
| Refseq | XP_024452475.1 | 6e-72 | agamous-like MADS-box protein AGL19 isoform X1 | ||||
| Refseq | XP_024452478.1 | 4e-72 | agamous-like MADS-box protein AGL19 isoform X3 | ||||
| Swissprot | Q38838 | 4e-50 | AGL14_ARATH; Agamous-like MADS-box protein AGL14 | ||||
| TrEMBL | B9GW46 | 1e-70 | B9GW46_POPTR; Uncharacterized protein | ||||
| STRING | cassava4.1_026051m | 3e-59 | (Manihot esculenta) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G11880.1 | 2e-52 | AGAMOUS-like 14 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Potri.003G119700.6 |
| Entrez Gene | 7479245 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




