![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Potri.003G146700.1 | ||||||||
| Common Name | POPTR_0003s14665g | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
| Family | ZF-HD | ||||||||
| Protein Properties | Length: 74aa MW: 8276.66 Da PI: 8.0613 | ||||||||
| Description | ZF-HD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | ZF-HD_dimer | 51.4 | 2.5e-16 | 18 | 53 | 3 | 39 |
ZF-HD_dimer 3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaa 39
rYkeClkNhAa++ g+a+DGCgEf+p +eeg+ +
Potri.003G146700.1 18 VERYKECLKNHAATICGKAIDGCGEFIPG-EEEGSLE 53
579*************************9.5555554 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| ProDom | PD125774 | 1.0E-9 | 20 | 54 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| Pfam | PF04770 | 4.5E-13 | 20 | 54 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| TIGRFAMs | TIGR01566 | 1.0E-14 | 20 | 53 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| PROSITE profile | PS51523 | 19.159 | 21 | 72 | IPR006456 | ZF-HD homeobox protein, Cys/His-rich dimerisation domain |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 74 aa Download sequence Send to blast |
MDIPLQASRR IKRPYKKVER YKECLKNHAA TICGKAIDGC GEFIPGEEEG SLEAPQVLNL 60 ILIHDMILNR NIN* |
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Potri.003G146700.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002306012.2 | 3e-17 | zinc-finger homeodomain protein 3 | ||||
| Refseq | XP_011005585.1 | 4e-17 | PREDICTED: zinc-finger homeodomain protein 3-like | ||||
| TrEMBL | B9GY33 | 1e-46 | B9GY33_POPTR; Uncharacterized protein | ||||
| STRING | POPTR_0004s14270.1 | 1e-16 | (Populus trichocarpa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF39528 | 2 | 2 | Representative plant | OGRP91 | 16 | 237 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G02540.1 | 4e-15 | homeobox protein 21 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Potri.003G146700.1 |
| Entrez Gene | 7497520 |




