![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Potri.004G021300.1 | ||||||||
| Common Name | POPTR_0004s02060g | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 75aa MW: 8532.22 Da PI: 4.0797 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 37.9 | 4.1e-12 | 25 | 68 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
++ ++++E+ l+++ +++ G + W++Ia +++ gRt++++ +w++
Potri.004G021300.1 25 KLEFSEDEETLIIRMFNLVGER-WSLIAGRIP-GRTAEEIEKYWNT 68
678*******************.*********.***********96 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 11.624 | 20 | 74 | IPR017930 | Myb domain |
| SMART | SM00717 | 8.9E-10 | 24 | 72 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 5.4E-11 | 26 | 68 | IPR001005 | SANT/Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 6.8E-15 | 27 | 70 | IPR009057 | Homeodomain-like |
| SuperFamily | SSF46689 | 2.34E-9 | 27 | 69 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 1.55E-8 | 27 | 68 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 75 aa Download sequence Send to blast |
MADTEHSSSD ETSVDSREET SQESKLEFSE DEETLIIRMF NLVGERWSLI AGRIPGRTAE 60 EIEKYWNTRC STSE* |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Pth.18949 | 7e-97 | bud | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in developing trichomes and non-root hair cells. {ECO:0000269|PubMed:15063185, ECO:0000269|PubMed:15584952}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | MYB-type transcription factor involved in epidermal cell fate specification. Acts as a negative regulator of trichome development, by mediating lateral inhibition. Promotes the formation of hair developing cells in H position in root epidermis, probably by inhibiting non-hair cell formation. {ECO:0000269|PubMed:15063185, ECO:0000269|PubMed:15584952}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Potri.004G021300.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | CU226488 | 1e-122 | CU226488.1 Populus EST from severe drought-stressed leaves. | |||
| GenBank | CU226991 | 1e-122 | CU226991.1 Populus EST from severe drought-stressed leaves. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006383940.1 | 1e-46 | MYB-like transcription factor ETC1 | ||||
| Swissprot | Q9LNI5 | 1e-15 | ETC1_ARATH; MYB-like transcription factor ETC1 | ||||
| TrEMBL | U5GK03 | 2e-45 | U5GK03_POPTR; Uncharacterized protein | ||||
| STRING | POPTR_0004s02060.1 | 4e-46 | (Populus trichocarpa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF2692 | 31 | 78 | Representative plant | OGRP3921 | 8 | 25 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G01380.1 | 6e-18 | MYB_related family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Potri.004G021300.1 |
| Entrez Gene | 18097403 |




