![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Potri.004G056900.1 | ||||||||
| Common Name | POPTR_0004s05580g | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
| Family | Dof | ||||||||
| Protein Properties | Length: 160aa MW: 17736 Da PI: 9.2865 | ||||||||
| Description | Dof family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | zf-Dof | 122.8 | 1.2e-38 | 39 | 97 | 2 | 60 |
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkk 60
+ek ++cprC+s++tkfCy+nny+++qPryfCk+C+ryWt+GGalrnvPvG+grrk k
Potri.004G056900.1 39 PEKVIPCPRCKSMETKFCYFNNYNVNQPRYFCKGCQRYWTAGGALRNVPVGAGRRKTKP 97
68899***************************************************986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| ProDom | PD007478 | 3.0E-28 | 38 | 96 | IPR003851 | Zinc finger, Dof-type |
| Pfam | PF02701 | 7.0E-32 | 41 | 96 | IPR003851 | Zinc finger, Dof-type |
| PROSITE profile | PS50884 | 28.192 | 43 | 97 | IPR003851 | Zinc finger, Dof-type |
| PROSITE pattern | PS01361 | 0 | 45 | 81 | IPR003851 | Zinc finger, Dof-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0010214 | Biological Process | seed coat development | ||||
| GO:0044212 | Molecular Function | transcription regulatory region DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 160 aa Download sequence Send to blast |
MASQEEGIKL FGATITLHDK QEGNKEDPNK ENPTTDKRPE KVIPCPRCKS METKFCYFNN 60 YNVNQPRYFC KGCQRYWTAG GALRNVPVGA GRRKTKPPGR VGLDGYSEGC LYDGSGGVHR 120 FELDGMVLEE WHLATTHGSS RHVFPVKRRR SGGSGGHTC* |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Pth.4226 | 0.0 | bud| catkin | ||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. Acts as a negative regulator in the phytochrome-mediated light responses. Controls phyB-mediated end-of-day response and the phyA-mediated anthocyanin accumulation. Not involved in direct flowering time regulation. {ECO:0000269|PubMed:19619493}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00166 | DAP | Transfer from AT1G29160 | Download |
| |||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Potri.004G056900.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By red or far-red light. Circadian-regulation. The transcript level rises progressively from dawn and decreases during the night. {ECO:0000269|PubMed:19619493}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002305070.1 | 1e-117 | dof zinc finger protein DOF1.5 | ||||
| Swissprot | P68350 | 9e-60 | DOF15_ARATH; Dof zinc finger protein DOF1.5 | ||||
| TrEMBL | B9H2I3 | 1e-116 | B9H2I3_POPTR; Uncharacterized protein | ||||
| STRING | POPTR_0004s05580.1 | 1e-117 | (Populus trichocarpa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF6483 | 32 | 51 | Representative plant | OGRP38 | 17 | 445 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G29160.1 | 4e-62 | Dof family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Potri.004G056900.1 |
| Entrez Gene | 7476341 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




