![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Potri.005G027400.1 | ||||||||
| Common Name | POPTR_0005s02750g | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 150aa MW: 16786.7 Da PI: 5.6943 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 158.3 | 1.2e-49 | 4 | 98 | 3 | 97 |
NF-YB 3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95
eqdr+lPianv+r+mkk+lP akisk+ak+t+qec++ef+sfvt+easdkcq+e+rkt+ngdd++wal +lGf+d++e++ yl+kyre+e+
Potri.005G027400.1 4 EQDRLLPIANVGRMMKKILPPTAKISKEAKQTMQECATEFVSFVTGEASDKCQKENRKTVNGDDICWALISLGFDDHAEAMVRYLHKYREAER 96
8*******************************************************************************************9 PP
NF-YB 96 ek 97
e+
Potri.005G027400.1 97 ER 98
97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 9.7E-50 | 3 | 123 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 2.31E-37 | 5 | 119 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 3.7E-26 | 8 | 72 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 1.9E-15 | 36 | 54 | No hit | No description |
| PRINTS | PR00615 | 1.9E-15 | 55 | 73 | No hit | No description |
| PRINTS | PR00615 | 1.9E-15 | 74 | 92 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 150 aa Download sequence Send to blast |
MDDEQDRLLP IANVGRMMKK ILPPTAKISK EAKQTMQECA TEFVSFVTGE ASDKCQKENR 60 KTVNGDDICW ALISLGFDDH AEAMVRYLHK YREAERERST NQHKASGTDQ GEESNHESKQ 120 PKQPIEAPNN GVEFRVLEKG NSSSFTNPS* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4g91_B | 2e-40 | 4 | 93 | 3 | 92 | Transcription factor HapC (Eurofung) |
| 4g92_B | 2e-40 | 4 | 93 | 3 | 92 | Transcription factor HapC (Eurofung) |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in flowers, siliques and young rosettes. {ECO:0000269|PubMed:11250072}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00133 | DAP | Transfer from AT1G09030 | Download |
| |||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Potri.005G027400.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006382502.1 | 1e-110 | nuclear transcription factor Y subunit B-4 | ||||
| Swissprot | O04027 | 3e-56 | NFYB4_ARATH; Nuclear transcription factor Y subunit B-4 | ||||
| TrEMBL | B9N4G4 | 1e-109 | B9N4G4_POPTR; Uncharacterized protein | ||||
| STRING | POPTR_0005s02750.1 | 1e-109 | (Populus trichocarpa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF805 | 32 | 131 | Representative plant | OGRP168 | 17 | 170 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G09030.1 | 1e-58 | nuclear factor Y, subunit B4 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Potri.005G027400.1 |
| Entrez Gene | 18098689 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




