![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Potri.005G140600.1 | ||||||||
| Common Name | POPTR_0005s18395g | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
| Family | TCP | ||||||||
| Protein Properties | Length: 41aa MW: 4790.36 Da PI: 10.1241 | ||||||||
| Description | TCP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | TCP | 39.6 | 1.9e-12 | 8 | 40 | 5 | 37 |
TCP 5 kdrhskihTkvggRdRRvRlsaecaarfFdLqd 37
+ h ++hTkv+g +RR+R++ +caa +F+ +d
Potri.005G140600.1 8 TLIHQDRHTKVEGHGRRIRIPTTCAAGIFQFTD 40
5669***************************99 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51369 | 9.627 | 11 | 41 | IPR017887 | Transcription factor TCP subgroup |
| Pfam | PF03634 | 1.6E-8 | 12 | 41 | IPR005333 | Transcription factor, TCP |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 41 aa Download sequence Send to blast |
HYDNNNKTLI HQDRHTKVEG HGRRIRIPTT CAAGIFQFTD K |
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Potri.005G140600.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| TrEMBL | A0A2K2AGK4 | 2e-22 | A0A2K2AGK4_POPTR; Uncharacterized protein (Fragment) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G45680.1 | 6e-12 | TCP family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Potri.005G140600.1 |
| Entrez Gene | 18099551 |




