![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Potri.006G130200.1 | ||||||||
| Common Name | POPTR_0006s13230g | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
| Family | S1Fa-like | ||||||||
| Protein Properties | Length: 89aa MW: 9778.54 Da PI: 10.1892 | ||||||||
| Description | S1Fa-like family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | S1FA | 138.2 | 1.8e-43 | 23 | 88 | 5 | 70 |
S1FA 5 kveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70
+e kGlnPGlivllv+gglll+fl+gny+ly yaqk+lPPrkkkP+skkk+k+e+lkqGv++PGe
Potri.006G130200.1 23 DAEPKGLNPGLIVLLVIGGLLLTFLIGNYVLYSYAQKTLPPRKKKPISKKKMKKERLKQGVSAPGE 88
5799*************************************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF04689 | 1.6E-40 | 24 | 88 | IPR006779 | DNA binding protein S1FA |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0016021 | Cellular Component | integral component of membrane | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 89 aa Download sequence Send to blast |
MEDDFEFSNS PPSFQNMGDL IKDAEPKGLN PGLIVLLVIG GLLLTFLIGN YVLYSYAQKT 60 LPPRKKKPIS KKKMKKERLK QGVSAPGE* |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Pth.2872 | 1e-138 | bud| stem | ||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | DNA-binding protein that specifically recognizes a negative element (S1F) within the RPS1 promoter. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Potri.006G130200.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | EF144560 | 1e-147 | EF144560.1 Populus trichocarpa clone WS01110_K04 unknown mRNA. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006381480.1 | 5e-57 | DNA-binding protein S1FA | ||||
| Swissprot | Q42337 | 3e-16 | S1FA2_ARATH; DNA-binding protein S1FA2 | ||||
| TrEMBL | A9P8U4 | 1e-55 | A9P8U4_POPTR; S1Fa-like family protein | ||||
| STRING | POPTR_0006s13230.1 | 2e-56 | (Populus trichocarpa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF5409 | 33 | 55 | Representative plant | OGRP5095 | 13 | 22 |
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Potri.006G130200.1 |
| Entrez Gene | 18100218 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




