PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.006G277800.5
Common NamePOPTR_0006s29250g
Organism
Populus trichocarpa
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family bZIP
Protein Properties Length: 209aa    MW: 22725.2 Da    PI: 8.2712
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.006G277800.5genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_154.33e-173991355
                        XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1  3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55
                        ++kr rr+ +NRe+ArrsR+RK+a +  Le  v+ +++eN +L k+l+  +++
  Potri.006G277800.5 39 DIKRIRRMVSNRESARRSRKRKQAHLSDLEVQVDHMTGENASLFKQLSDATQQ 91
                        68*****************************************9888776665 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1701.3E-133494No hitNo description
SMARTSM003387.5E-1737101IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.80639102IPR004827Basic-leucine zipper domain
SuperFamilySSF579592.33E-134092No hitNo description
PfamPF001703.7E-154090IPR004827Basic-leucine zipper domain
CDDcd147023.40E-194293No hitNo description
PROSITE patternPS0003604459IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0071333Biological Processcellular response to glucose stimulus
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0042803Molecular Functionprotein homodimerization activity
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 209 aa     Download sequence    Send to blast
MSANKPRVKD SQTRVAASVS SPDQSDEDGL SEQSTNPHDI KRIRRMVSNR ESARRSRKRK  60
QAHLSDLEVQ VDHMTGENAS LFKQLSDATQ QFRTAETNRR VLNSDVEALR AKVKLAEDMV  120
ARGSLTCNNL NQFLQSHLTS PQLLNNHNLH LMPNVSPTIT IQGDEAYAGM SVSGQNSGLG  180
LGSADISNGN LNNGILSDAA SCITNIWS*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
15359RRSRKRK
25360RRSRKRKQ
35560SRKRKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.110880.0stem
Expression -- Description ? help Back to Top
Source Description
UniprotDEVELOPMENTAL STAGE: Present in silique vasculature and funiculi. In the anthers, restricted to the connective tissue at pre- and post-dehiscence stages and detected in the vascular tissue of the stamen filament. {ECO:0000269|PubMed:18841482}.
UniprotTISSUE SPECIFICITY: Expressed in roots, shoots, stems, young leaves, and flowers, mostly in vascular tissues (e.g. phloem). {ECO:0000269|PubMed:12657652, ECO:0000269|PubMed:18841482}.
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.006G277800.5
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Repressed by glucose. {ECO:0000269|PubMed:18841482}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankGU2750603e-67GU275060.1 Populus balsamifera isolate GIL14 haplotype A G/HBF1-related bZIP protein gene, partial sequence.
GenBankGU2750613e-67GU275061.1 Populus balsamifera isolate GIL14 haplotype B G/HBF1-related bZIP protein gene, partial sequence.
GenBankGU2750623e-67GU275062.1 Populus balsamifera isolate HAY07 haplotype A G/HBF1-related bZIP protein gene, partial sequence.
GenBankGU2750633e-67GU275063.1 Populus balsamifera isolate HAY07 haplotype B G/HBF1-related bZIP protein gene, partial sequence.
GenBankGU2750643e-67GU275064.1 Populus balsamifera isolate INU03 haplotype A G/HBF1-related bZIP protein gene, partial sequence.
GenBankGU2750653e-67GU275065.1 Populus balsamifera isolate INU03 haplotype B G/HBF1-related bZIP protein gene, partial sequence.
GenBankGU2750663e-67GU275066.1 Populus balsamifera isolate KUU07 haplotype A G/HBF1-related bZIP protein gene, partial sequence.
GenBankGU2750673e-67GU275067.1 Populus balsamifera isolate KUU07 haplotype B G/HBF1-related bZIP protein gene, partial sequence.
GenBankGU2750683e-67GU275068.1 Populus balsamifera isolate LOV02 haplotype A G/HBF1-related bZIP protein gene, partial sequence.
GenBankGU2750693e-67GU275069.1 Populus balsamifera isolate LOV02 haplotype B G/HBF1-related bZIP protein gene, partial sequence.
GenBankGU2750703e-67GU275070.1 Populus balsamifera isolate MGR10 haplotype A G/HBF1-related bZIP protein gene, partial sequence.
GenBankGU2750713e-67GU275071.1 Populus balsamifera isolate MGR10 haplotype B G/HBF1-related bZIP protein gene, partial sequence.
GenBankGU2750723e-67GU275072.1 Populus balsamifera isolate NWL07 haplotype A G/HBF1-related bZIP protein gene, partial sequence.
GenBankGU2750733e-67GU275073.1 Populus balsamifera isolate NWL07 haplotype B G/HBF1-related bZIP protein gene, partial sequence.
GenBankGU2750743e-67GU275074.1 Populus balsamifera isolate POR11 haplotype A G/HBF1-related bZIP protein gene, partial sequence.
GenBankGU2750753e-67GU275075.1 Populus balsamifera isolate POR11 haplotype B G/HBF1-related bZIP protein gene, partial sequence.
GenBankGU2750763e-67GU275076.1 Populus balsamifera isolate RNA13 haplotype A G/HBF1-related bZIP protein gene, partial sequence.
GenBankGU2750773e-67GU275077.1 Populus balsamifera isolate RNA13 haplotype B G/HBF1-related bZIP protein gene, partial sequence.
GenBankGU2750783e-67GU275078.1 Populus balsamifera isolate WHR03 haplotype A G/HBF1-related bZIP protein gene, partial sequence.
GenBankGU2750793e-67GU275079.1 Populus balsamifera isolate WHR03 haplotype B G/HBF1-related bZIP protein gene, partial sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006382195.11e-151basic leucine zipper 9
SwissprotQ9FUD32e-64BZIP9_ARATH; Basic leucine zipper 9
TrEMBLU5GEY11e-150U5GEY1_POPTR; Uncharacterized protein
STRINGPOPTR_0006s29250.11e-150(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24800.12e-65basic leucine zipper 9
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Ortiz-Espín A, et al.
    Mitochondrial AtTrxo1 is transcriptionally regulated by AtbZIP9 and AtAZF2 and affects seed germination under saline conditions.
    J. Exp. Bot., 2017. 68(5): p. 1025-1038
    [PMID:28184497]
  3. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]
  4. Pedrotti L, et al.
    Snf1-RELATED KINASE1-Controlled C/S1-bZIP Signaling Activates Alternative Mitochondrial Metabolic Pathways to Ensure Plant Survival in Extended Darkness.
    Plant Cell, 2018. 30(2): p. 495-509
    [PMID:29348240]