![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Potri.006G277800.7 | ||||||||
| Common Name | POPTR_0006s29250g | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
| Family | bZIP | ||||||||
| Protein Properties | Length: 219aa MW: 23712.3 Da PI: 8.2712 | ||||||||
| Description | bZIP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | bZIP_1 | 54.2 | 3.2e-17 | 49 | 101 | 3 | 55 |
XXCHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
bZIP_1 3 elkrerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkke 55
++kr rr+ +NRe+ArrsR+RK+a + Le v+ +++eN +L k+l+ +++
Potri.006G277800.7 49 DIKRIRRMVSNRESARRSRKRKQAHLSDLEVQVDHMTGENASLFKQLSDATQQ 101
68*****************************************9888776665 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00338 | 7.5E-17 | 47 | 111 | IPR004827 | Basic-leucine zipper domain |
| PROSITE profile | PS50217 | 10.806 | 49 | 112 | IPR004827 | Basic-leucine zipper domain |
| Pfam | PF00170 | 4.4E-15 | 50 | 101 | IPR004827 | Basic-leucine zipper domain |
| SuperFamily | SSF57959 | 2.41E-13 | 50 | 102 | No hit | No description |
| Gene3D | G3DSA:1.20.5.170 | 1.1E-14 | 51 | 103 | No hit | No description |
| CDD | cd14702 | 1.01E-19 | 52 | 103 | No hit | No description |
| PROSITE pattern | PS00036 | 0 | 54 | 69 | IPR004827 | Basic-leucine zipper domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0071333 | Biological Process | cellular response to glucose stimulus | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0042803 | Molecular Function | protein homodimerization activity | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 219 aa Download sequence Send to blast |
MAGNWSVGSP MSANKPRVKD SQTRVAASVS SPDQSDEDGL SEQSTNPHDI KRIRRMVSNR 60 ESARRSRKRK QAHLSDLEVQ VDHMTGENAS LFKQLSDATQ QFRTAETNRR VLNSDVEALR 120 AKVKLAEDMV ARGSLTCNNL NQFLQSHLTS PQLLNNHNLH LMPNVSPTIT IQGDEAYAGM 180 SVSGQNSGLG LGSADISNGN LNNGILSDAA SCITNIWS* |
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 63 | 69 | RRSRKRK |
| 2 | 63 | 70 | RRSRKRKQ |
| 3 | 65 | 70 | SRKRKQ |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Pth.11088 | 0.0 | stem | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: Present in silique vasculature and funiculi. In the anthers, restricted to the connective tissue at pre- and post-dehiscence stages and detected in the vascular tissue of the stamen filament. {ECO:0000269|PubMed:18841482}. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in roots, shoots, stems, young leaves, and flowers, mostly in vascular tissues (e.g. phloem). {ECO:0000269|PubMed:12657652, ECO:0000269|PubMed:18841482}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Potri.006G277800.7 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Repressed by glucose. {ECO:0000269|PubMed:18841482}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | GU275060 | 3e-67 | GU275060.1 Populus balsamifera isolate GIL14 haplotype A G/HBF1-related bZIP protein gene, partial sequence. | |||
| GenBank | GU275061 | 3e-67 | GU275061.1 Populus balsamifera isolate GIL14 haplotype B G/HBF1-related bZIP protein gene, partial sequence. | |||
| GenBank | GU275062 | 3e-67 | GU275062.1 Populus balsamifera isolate HAY07 haplotype A G/HBF1-related bZIP protein gene, partial sequence. | |||
| GenBank | GU275063 | 3e-67 | GU275063.1 Populus balsamifera isolate HAY07 haplotype B G/HBF1-related bZIP protein gene, partial sequence. | |||
| GenBank | GU275064 | 3e-67 | GU275064.1 Populus balsamifera isolate INU03 haplotype A G/HBF1-related bZIP protein gene, partial sequence. | |||
| GenBank | GU275065 | 3e-67 | GU275065.1 Populus balsamifera isolate INU03 haplotype B G/HBF1-related bZIP protein gene, partial sequence. | |||
| GenBank | GU275066 | 3e-67 | GU275066.1 Populus balsamifera isolate KUU07 haplotype A G/HBF1-related bZIP protein gene, partial sequence. | |||
| GenBank | GU275067 | 3e-67 | GU275067.1 Populus balsamifera isolate KUU07 haplotype B G/HBF1-related bZIP protein gene, partial sequence. | |||
| GenBank | GU275068 | 3e-67 | GU275068.1 Populus balsamifera isolate LOV02 haplotype A G/HBF1-related bZIP protein gene, partial sequence. | |||
| GenBank | GU275069 | 3e-67 | GU275069.1 Populus balsamifera isolate LOV02 haplotype B G/HBF1-related bZIP protein gene, partial sequence. | |||
| GenBank | GU275070 | 3e-67 | GU275070.1 Populus balsamifera isolate MGR10 haplotype A G/HBF1-related bZIP protein gene, partial sequence. | |||
| GenBank | GU275071 | 3e-67 | GU275071.1 Populus balsamifera isolate MGR10 haplotype B G/HBF1-related bZIP protein gene, partial sequence. | |||
| GenBank | GU275072 | 3e-67 | GU275072.1 Populus balsamifera isolate NWL07 haplotype A G/HBF1-related bZIP protein gene, partial sequence. | |||
| GenBank | GU275073 | 3e-67 | GU275073.1 Populus balsamifera isolate NWL07 haplotype B G/HBF1-related bZIP protein gene, partial sequence. | |||
| GenBank | GU275074 | 3e-67 | GU275074.1 Populus balsamifera isolate POR11 haplotype A G/HBF1-related bZIP protein gene, partial sequence. | |||
| GenBank | GU275075 | 3e-67 | GU275075.1 Populus balsamifera isolate POR11 haplotype B G/HBF1-related bZIP protein gene, partial sequence. | |||
| GenBank | GU275076 | 3e-67 | GU275076.1 Populus balsamifera isolate RNA13 haplotype A G/HBF1-related bZIP protein gene, partial sequence. | |||
| GenBank | GU275077 | 3e-67 | GU275077.1 Populus balsamifera isolate RNA13 haplotype B G/HBF1-related bZIP protein gene, partial sequence. | |||
| GenBank | GU275078 | 3e-67 | GU275078.1 Populus balsamifera isolate WHR03 haplotype A G/HBF1-related bZIP protein gene, partial sequence. | |||
| GenBank | GU275079 | 3e-67 | GU275079.1 Populus balsamifera isolate WHR03 haplotype B G/HBF1-related bZIP protein gene, partial sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006382195.1 | 1e-154 | basic leucine zipper 9 | ||||
| Swissprot | Q9FUD3 | 7e-67 | BZIP9_ARATH; Basic leucine zipper 9 | ||||
| TrEMBL | U5GEY1 | 1e-153 | U5GEY1_POPTR; Uncharacterized protein | ||||
| STRING | POPTR_0006s29250.1 | 1e-153 | (Populus trichocarpa) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G24800.1 | 1e-67 | basic leucine zipper 9 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Potri.006G277800.7 |
| Entrez Gene | 18100783 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




