![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Potri.008G217900.1 | ||||||||
| Common Name | POPTR_0008s22520g | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 151aa MW: 16562.5 Da PI: 5.3717 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 170.4 | 2.1e-53 | 19 | 113 | 3 | 97 |
NF-YB 3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrel 93
eqdr+lPianv+rimk++lPanakisk+aket+qec+sefisfvt+eas+kc++e+rkt+ngdd++wa++ lGf+dy+ pl+ yl++yre+
Potri.008G217900.1 19 EQDRLLPIANVGRIMKQILPANAKISKEAKETMQECASEFISFVTGEASEKCRKERRKTVNGDDVCWAMGALGFDDYAGPLRRYLQRYREI 109
8****************************************************************************************** PP
NF-YB 94 egek 97
eg++
Potri.008G217900.1 110 EGDR 113
**97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 4.4E-51 | 18 | 134 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 1.08E-39 | 20 | 130 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 5.4E-27 | 23 | 87 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 1.4E-16 | 51 | 69 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 54 | 70 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 1.4E-16 | 70 | 88 | No hit | No description |
| PRINTS | PR00615 | 1.4E-16 | 89 | 107 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 151 aa Download sequence Send to blast |
MVDNVGAGAS SDDGGVKLEQ DRLLPIANVG RIMKQILPAN AKISKEAKET MQECASEFIS 60 FVTGEASEKC RKERRKTVNG DDVCWAMGAL GFDDYAGPLR RYLQRYREIE GDRANQEKPA 120 NTNNTSIADQ EKEAPPSSSS SYRNNQGIRM * |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5g49_A | 3e-43 | 19 | 108 | 8 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in flowers and siliques. {ECO:0000269|PubMed:11250072}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Potri.008G217900.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006380166.2 | 1e-109 | nuclear transcription factor Y subunit B-5 | ||||
| Swissprot | O82248 | 9e-57 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
| TrEMBL | A0A2K1ZLA2 | 1e-107 | A0A2K1ZLA2_POPTR; Uncharacterized protein | ||||
| STRING | POPTR_0008s22520.1 | 1e-107 | (Populus trichocarpa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF805 | 32 | 131 | Representative plant | OGRP168 | 17 | 170 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G47810.1 | 4e-59 | nuclear factor Y, subunit B5 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Potri.008G217900.1 |
| Entrez Gene | 18101826 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




