![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Potri.010G098100.1 | ||||||||
| Common Name | POPTR_0010s10840g | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 62aa MW: 6859.9 Da PI: 10.22 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 37.5 | 3.1e-12 | 2 | 37 | 15 | 50 |
HHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
SRF-TF 15 kRrngilKKAeELSvLCdaevaviifsstgklyeys 50
kR+ ++ KKA+ELS+LC++ v vi ++g + +++
Potri.010G098100.1 2 KRLPTLKKKASELSILCGIPVRVISSWPDGIFDTWP 37
9**********************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF00319 | 1.4E-8 | 1 | 36 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 4.97E-10 | 2 | 54 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 62 aa Download sequence Send to blast |
NKRLPTLKKK ASELSILCGI PVRVISSWPD GIFDTWPENR NEVKTLVSEY KQAVVSTSSN 60 K* |
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Potri.010G098100.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| TrEMBL | A0A2K1YRL3 | 4e-36 | A0A2K1YRL3_POPTR; Uncharacterized protein (Fragment) | ||||
| STRING | POPTR_0010s10840.1 | 2e-35 | (Populus trichocarpa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF17113 | 4 | 8 | Representative plant | OGRP6766 | 2 | 18 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G02235.1 | 2e-14 | AGAMOUS-like 51 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Potri.010G098100.1 |
| Entrez Gene | 18102533 |




