PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.011G026300.1
Common NamePOPTR_0011s00390g
Organism
Populus trichocarpa
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family MYB_related
Protein Properties Length: 75aa    MW: 8686.46 Da    PI: 4.2403
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.011G026300.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding37.94.1e-122568146
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                        ++ ++++E+ l+++ +++ G + W++Ia +++ gRt++++  +w++
  Potri.011G026300.1 25 KLEFSEDEETLIIRMFNLVGER-WSLIAGRIP-GRTAEEIEKYWNT 68
                        678*******************.*********.***********96 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.9382074IPR017930Myb domain
SMARTSM007177.1E-102472IPR001005SANT/Myb domain
PfamPF002495.4E-112668IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-142769IPR009057Homeodomain-like
SuperFamilySSF466891.64E-92770IPR009057Homeodomain-like
CDDcd001672.94E-82768No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 75 aa     Download sequence    Send to blast
MADSEHSSSD ETFVYSREET SKESKLEFSE DEETLIIRMF NLVGERWSLI AGRIPGRTAE  60
EIEKYWNTRY STSE*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pth.189491e-125bud
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in developing trichomes and non-root hair cells. {ECO:0000269|PubMed:15063185, ECO:0000269|PubMed:15584952}.
Functional Description ? help Back to Top
Source Description
UniProtMYB-type transcription factor involved in epidermal cell fate specification. Acts as a negative regulator of trichome development, by mediating lateral inhibition. Promotes the formation of hair developing cells in H position in root epidermis, probably by inhibiting non-hair cell formation. {ECO:0000269|PubMed:15063185, ECO:0000269|PubMed:15584952}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.011G026300.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCU2264885e-94CU226488.1 Populus EST from severe drought-stressed leaves.
GenBankCU2269915e-94CU226991.1 Populus EST from severe drought-stressed leaves.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002317211.11e-46MYB-like transcription factor ETC1
SwissprotQ9LNI56e-16ETC1_ARATH; MYB-like transcription factor ETC1
TrEMBLB9HZL83e-45B9HZL8_POPTR; Uncharacterized protein
STRINGPOPTR_0011s00390.15e-46(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF26923178
Representative plantOGRP3921825
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G01380.12e-18MYB_related family protein
Publications ? help Back to Top
  1. Savage N, et al.
    Positional signaling and expression of ENHANCER OF TRY AND CPC1 are tuned to increase root hair density in response to phosphate deficiency in Arabidopsis thaliana.
    PLoS ONE, 2013. 8(10): p. e75452
    [PMID:24130712]
  2. Wada T,Hayashi N,Tominaga-Wada R
    Root hair formation at the root-hypocotyl junction in CPC-LIKE MYB double and triple mutants of Arabidopsis.
    Plant Signal Behav, 2015. 10(11): p. e1089372
    [PMID:26339713]
  3. Huang M,Hu Y,Liu X,Li Y,Hou X
    Arabidopsis LEAFY COTYLEDON1 controls cell fate determination during post-embryonic development.
    Front Plant Sci, 2015. 6: p. 955
    [PMID:26579186]
  4. Wada T,Tominaga-Wada R
    CAPRICE family genes control flowering time through both promoting and repressing CONSTANS and FLOWERING LOCUS T expression.
    Plant Sci., 2015. 241: p. 260-5
    [PMID:26706076]
  5. Hegebarth D,Buschhaus C,Wu M,Bird D,Jetter R
    The composition of surface wax on trichomes of Arabidopsis thaliana differs from wax on other epidermal cells.
    Plant J., 2016. 88(5): p. 762-774
    [PMID:27496682]
  6. Tominaga-Wada R,Kurata T,Wada T
    Localization of ENHANCER OF TRY AND CPC1 protein in Arabidopsis root epidermis.
    J. Plant Physiol., 2017. 214: p. 48-52
    [PMID:28437677]
  7. Tominaga-Wada R,Kurata T,Wada T
    Localization of the CAPRICE-ENHANCER OF TRY AND CPC1 chimera protein in Arabidopsis root epidermis.
    Biosci. Biotechnol. Biochem., 2017. 81(9): p. 1762-1767
    [PMID:28644769]
  8. Tominaga-Wada R,Wada T
    Extended C termini of CPC-LIKE MYB proteins confer functional diversity in Arabidopsis epidermal cell differentiation.
    Development, 2017. 144(13): p. 2375-2380
    [PMID:28676568]
  9. Tominaga-Wada R,Wada T
    Effect of amino acid substitution of CAPRICE on cell-to-cell movement ability in Arabidopsis root epidermis.
    Dev. Biol., 2018. 435(1): p. 1-5
    [PMID:29337129]