![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Potri.012G133000.4 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
| Family | MIKC_MADS | ||||||||
| Protein Properties | Length: 168aa MW: 19255.2 Da PI: 9.9395 | ||||||||
| Description | MIKC_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 91.4 | 4.6e-29 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
krien + rqvtfskR+ng+lKKA+ELS+LCdaevaviifs++g+l+ ++s
Potri.012G133000.4 9 KRIENATSRQVTFSKRKNGLLKKAYELSILCDAEVAVIIFSQKGTLFKFAS 59
79**********************************************986 PP
| |||||||
| 2 | K-box | 66 | 1.3e-22 | 83 | 158 | 9 | 84 |
K-box 9 leeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkke 84
e+ e+l+qe+a++ k+ie ++ qR+llG+dL+s+s +eL+ + +qLe sl++iR++K++l++eqie+lq k
Potri.012G133000.4 83 DVEQSKEQLRQESANMAKKIEIIEILQRKLLGQDLDSCSPEELHDIDNQLEISLSNIRARKTQLFKEQIEQLQAKI 158
44566889*****************************************************************985 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 2.8E-38 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 31.006 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 1.10E-36 | 2 | 79 | No hit | No description |
| SuperFamily | SSF55455 | 1.96E-29 | 3 | 75 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.7E-30 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 5.4E-26 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.7E-30 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 3.7E-30 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF01486 | 7.5E-21 | 86 | 157 | IPR002487 | Transcription factor, K-box |
| PROSITE profile | PS51297 | 12.841 | 88 | 167 | IPR002487 | Transcription factor, K-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 168 aa Download sequence Send to blast |
MARGKVQLKR IENATSRQVT FSKRKNGLLK KAYELSILCD AEVAVIIFSQ KGTLFKFASI 60 DQIQKTIDRY RKNAKQLHTD RIDVEQSKEQ LRQESANMAK KIEIIEILQR KLLGQDLDSC 120 SPEELHDIDN QLEISLSNIR ARKTQLFKEQ IEQLQAKIVV NGECKVN* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5f28_A | 2e-19 | 1 | 61 | 1 | 61 | MEF2C |
| 5f28_B | 2e-19 | 1 | 61 | 1 | 61 | MEF2C |
| 5f28_C | 2e-19 | 1 | 61 | 1 | 61 | MEF2C |
| 5f28_D | 2e-19 | 1 | 61 | 1 | 61 | MEF2C |
| 6byy_A | 2e-19 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
| 6byy_B | 2e-19 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
| 6byy_C | 2e-19 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
| 6byy_D | 2e-19 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
| 6bz1_A | 2e-19 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
| 6bz1_B | 2e-19 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
| 6bz1_C | 2e-19 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
| 6bz1_D | 2e-19 | 1 | 61 | 1 | 61 | MEF2 CHIMERA |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: Expressed in the shoot apical meristem (SAM) during the vegetative phase and the floral transition. After floral transition, expressed in apical meristem (AM), inflorescence meristem (IM) and floral primordia. {ECO:0000269|PubMed:21609362}. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in quiescent center (QC) cells of root tips (PubMed:18162590, PubMed:21689171). Expressed at the base of the petiole of cotyledons and leaves, in flower buds, petals, sepals and abscission zone of flowers and siliques. {ECO:0000269|PubMed:18162590, ECO:0000269|PubMed:21689171}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | MADS-box transcription factor that acts with AGL71 and AGL72 in the control of flowering time. Promotes flowering at the shoot apical and axillary meristems. Seems to act through a gibberellin-dependent pathway. Interacts genetically with SOC1 and its expression is directly regulated by SOC1 (PubMed:21609362). Plays a role in controlling flower organ senescence and abscission by repressing ethylene responses and regulating the expression of BOP2 and IDA (PubMed:21689171). {ECO:0000269|PubMed:21609362, ECO:0000269|PubMed:21689171}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Potri.012G133000.4 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002318261.1 | 1e-108 | MADS-box protein AGL42 | ||||
| Refseq | XP_024437836.1 | 1e-108 | MADS-box protein AGL42 | ||||
| Swissprot | Q9FIS1 | 6e-61 | AGL42_ARATH; MADS-box protein AGL42 | ||||
| TrEMBL | B9I4G5 | 1e-107 | B9I4G5_POPTR; Uncharacterized protein | ||||
| STRING | EOY23041 | 1e-69 | (Theobroma cacao) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G62165.3 | 2e-63 | AGAMOUS-like 42 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Potri.012G133000.4 |




