![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Potri.013G019500.1 | ||||||||
| Common Name | POPTR_0013s02020g | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 144aa MW: 16469.3 Da PI: 5.3344 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 146.4 | 6.2e-46 | 5 | 99 | 3 | 97 |
NF-YB 3 eqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95
+qd++lPianv+r+mk+ lP a++sk+ak+ +qec++efisfvtseas+kc++e+rk++ngdd++wal++lGf+dy+++ yl+kyre+e+
Potri.013G019500.1 5 KQDQLLPIANVGRVMKQHLPPTARVSKEAKQRMQECATEFISFVTSEASNKCRKENRKALNGDDVCWALSSLGFDDYADTTVRYLHKYREAER 97
79******************************************************************************************9 PP
NF-YB 96 ek 97
ek
Potri.013G019500.1 98 EK 99
97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 3.0E-46 | 4 | 123 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 6.89E-37 | 6 | 120 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 5.4E-23 | 9 | 73 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 3.1E-15 | 37 | 55 | No hit | No description |
| PRINTS | PR00615 | 3.1E-15 | 56 | 74 | No hit | No description |
| PRINTS | PR00615 | 3.1E-15 | 75 | 93 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 144 aa Download sequence Send to blast |
MDDDKQDQLL PIANVGRVMK QHLPPTARVS KEAKQRMQEC ATEFISFVTS EASNKCRKEN 60 RKALNGDDVC WALSSLGFDD YADTTVRYLH KYREAEREKA DQKKATDTEK VNKDEESNHT 120 SCQAVQQQTD QIPEPTILEF RFL* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4g91_B | 3e-36 | 6 | 94 | 4 | 92 | Transcription factor HapC (Eurofung) |
| 4g92_B | 3e-36 | 6 | 94 | 4 | 92 | Transcription factor HapC (Eurofung) |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in flowers, siliques and young rosettes. {ECO:0000269|PubMed:11250072}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Potri.013G019500.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002319000.1 | 1e-104 | nuclear transcription factor Y subunit B-4 | ||||
| Swissprot | O04027 | 7e-49 | NFYB4_ARATH; Nuclear transcription factor Y subunit B-4 | ||||
| TrEMBL | B9I7Q2 | 1e-103 | B9I7Q2_POPTR; Uncharacterized protein | ||||
| STRING | POPTR_0013s02020.1 | 1e-104 | (Populus trichocarpa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF805 | 32 | 131 | Representative plant | OGRP168 | 17 | 170 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G09030.1 | 3e-51 | nuclear factor Y, subunit B4 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Potri.013G019500.1 |
| Entrez Gene | 7473275 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




