![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Potri.014G124400.1 | ||||||||
| Common Name | POPTR_0014s11940g | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
| Family | GATA | ||||||||
| Protein Properties | Length: 134aa MW: 14704.8 Da PI: 10.4416 | ||||||||
| Description | GATA family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | GATA | 52.9 | 4.9e-17 | 28 | 62 | 1 | 35 |
GATA 1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35
C C+tt Tp+WR gp g++tLCnaCG+++rkk++
Potri.014G124400.1 28 CMDCQTTRTPCWRGGPAGPRTLCNACGIRQRKKRR 62
999*****************************986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF57716 | 2.0E-13 | 22 | 62 | No hit | No description |
| PROSITE profile | PS50114 | 11.648 | 22 | 58 | IPR000679 | Zinc finger, GATA-type |
| SMART | SM00401 | 2.6E-12 | 22 | 79 | IPR000679 | Zinc finger, GATA-type |
| Gene3D | G3DSA:3.30.50.10 | 1.2E-13 | 25 | 62 | IPR013088 | Zinc finger, NHR/GATA-type |
| CDD | cd00202 | 1.07E-12 | 27 | 78 | No hit | No description |
| Pfam | PF00320 | 1.2E-14 | 28 | 62 | IPR000679 | Zinc finger, GATA-type |
| PROSITE pattern | PS00344 | 0 | 28 | 53 | IPR000679 | Zinc finger, GATA-type |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0030154 | Biological Process | cell differentiation | ||||
| GO:0045944 | Biological Process | positive regulation of transcription from RNA polymerase II promoter | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0005667 | Cellular Component | transcription factor complex | ||||
| GO:0000977 | Molecular Function | RNA polymerase II regulatory region sequence-specific DNA binding | ||||
| GO:0001085 | Molecular Function | RNA polymerase II transcription factor binding | ||||
| GO:0001228 | Molecular Function | transcriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific binding | ||||
| GO:0003682 | Molecular Function | chromatin binding | ||||
| GO:0008270 | Molecular Function | zinc ion binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 134 aa Download sequence Send to blast |
MDFNTKGSES EDMDSTQSSK GNEIKRRCMD CQTTRTPCWR GGPAGPRTLC NACGIRQRKK 60 RRALHGSDKG GAERSKNKIA KSSNSSKLGV SLKLDLMGFR RDGILQEDWK RKLGEEEQAA 120 ILLMALSCGL VRA* |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional regulator that specifically binds 5'-GATA-3' or 5'-GAT-3' motifs within gene promoters. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Potri.014G124400.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | EF148247 | 1e-116 | EF148247.1 Populus trichocarpa x Populus deltoides clone WS01312_C13 unknown mRNA. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002320320.2 | 5e-93 | GATA transcription factor 16 | ||||
| Swissprot | Q9FJ10 | 7e-32 | GAT16_ARATH; GATA transcription factor 16 | ||||
| TrEMBL | B9I9M5 | 1e-91 | B9I9M5_POPTR; Uncharacterized protein | ||||
| STRING | POPTR_0014s11940.1 | 2e-92 | (Populus trichocarpa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF1569 | 32 | 98 | Representative plant | OGRP68 | 17 | 287 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G49300.1 | 8e-32 | GATA transcription factor 16 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Potri.014G124400.1 |
| Entrez Gene | 7491275 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




