![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Potri.015G098400.6 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
| Family | MIKC_MADS | ||||||||
| Protein Properties | Length: 190aa MW: 22025.4 Da PI: 10.791 | ||||||||
| Description | MIKC_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 89.2 | 2.1e-28 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
krien+ rqvtfskRrng+lKKA+ELS+LC+aev++iifs++gk+y +ss
Potri.015G098400.6 9 KRIENSASRQVTFSKRRNGLLKKAFELSILCEAEVSLIIFSPSGKFYQFSS 59
79***********************************************96 PP
| |||||||
| 2 | K-box | 64.2 | 4.9e-22 | 80 | 157 | 8 | 85 |
K-box 8 sleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkek 85
++ ++ e ++ e++ L++ i + + ++Rh++Ged+ +L lkeL+qLe+qL++++++iRskK++++ e+i+ l+ +
Potri.015G098400.6 80 DQRSRSLEFWRCEIEELRRTITKTEAQLRHFIGEDIAPLGLKELKQLERQLKTGVERIRSKKKRVISEHIKLLKSEVR 157
46777899***************************************************************9998766 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00432 | 1.3E-38 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 31.693 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SuperFamily | SSF55455 | 1.2E-31 | 2 | 88 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 3.13E-36 | 2 | 70 | No hit | No description |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.3E-29 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 1.7E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.3E-29 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 2.3E-29 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF01486 | 1.6E-19 | 83 | 157 | IPR002487 | Transcription factor, K-box |
| PROSITE profile | PS51297 | 10.912 | 86 | 189 | IPR002487 | Transcription factor, K-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 190 aa Download sequence Send to blast |
MGRGKVELKR IENSASRQVT FSKRRNGLLK KAFELSILCE AEVSLIIFSP SGKFYQFSSH 60 DMERSVARYR SEVGLPGTND QRSRSLEFWR CEIEELRRTI TKTEAQLRHF IGEDIAPLGL 120 KELKQLERQL KTGVERIRSK KKRVISEHIK LLKSEVRRSS SSYAPSYVSS TIRAHINRLF 180 LDLYDHLRI* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 6byy_A | 3e-21 | 1 | 69 | 1 | 69 | MEF2 CHIMERA |
| 6byy_B | 3e-21 | 1 | 69 | 1 | 69 | MEF2 CHIMERA |
| 6byy_C | 3e-21 | 1 | 69 | 1 | 69 | MEF2 CHIMERA |
| 6byy_D | 3e-21 | 1 | 69 | 1 | 69 | MEF2 CHIMERA |
| 6bz1_A | 3e-21 | 1 | 69 | 1 | 69 | MEF2 CHIMERA |
| 6bz1_B | 3e-21 | 1 | 69 | 1 | 69 | MEF2 CHIMERA |
| 6bz1_C | 3e-21 | 1 | 69 | 1 | 69 | MEF2 CHIMERA |
| 6bz1_D | 3e-21 | 1 | 69 | 1 | 69 | MEF2 CHIMERA |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Pth.12131 | 0.0 | bud| stem | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Mostly expressed in the outer layers of the root meristem (lateral root cap and epidermis) and in the central cylinder cells of mature roots. Also present in rosette leaves and seedlings and, to a lesser extent, in cauline leaves and flowers. Enriched in apices including the shoot apical meristem and developing leaf primordia. {ECO:0000269|PubMed:11115127, ECO:0000269|PubMed:12837945, ECO:0000269|PubMed:12949148, ECO:0000269|PubMed:16778081}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor that promotes flowering, especially in response to vernalization by short periods of cold, in an FLC-inpedendent manner. {ECO:0000269|PubMed:16778081}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Potri.015G098400.6 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Maintained at very low levels by the polycomb-group (PcG) proteins MSI1, CLF, and EMF2 via histone methylation (H3K27me3). Derepressed upon cold treatment (vernalization). {ECO:0000269|PubMed:16778081}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | EF145025 | 0.0 | EF145025.1 Populus trichocarpa clone WS0111_J17 unknown mRNA. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002321711.1 | 1e-108 | truncated transcription factor CAULIFLOWER D | ||||
| Swissprot | O82743 | 3e-43 | AGL19_ARATH; Agamous-like MADS-box protein AGL19 | ||||
| TrEMBL | A9PA19 | 1e-106 | A9PA19_POPTR; Uncharacterized protein | ||||
| STRING | VIT_17s0000g01230.t01 | 2e-77 | (Vitis vinifera) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G22950.1 | 3e-37 | AGAMOUS-like 19 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Potri.015G098400.6 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




