![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Potri.015G135900.1 | ||||||||
| Common Name | POPTR_0015s13870g | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
| Family | LBD | ||||||||
| Protein Properties | Length: 103aa MW: 11517.3 Da PI: 9.1344 | ||||||||
| Description | LBD family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | DUF260 | 130.8 | 5.7e-41 | 1 | 100 | 1 | 100 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlk 91
+CaaCk+lrr+C++dC+++pyfp+++p++fa+vh+++Gasnv k+l++lp + r +a++sl+yeA++r++dPvyG+vg+++ l+qq+++++
Potri.015G135900.1 1 RCAACKYLRRRCPSDCIFSPYFPSNNPRRFACVHRIHGASNVAKMLQQLPAHLRAEAANSLYYEAQCRTQDPVYGCVGILSLLHQQIHSVE 91
6****************************************************************************************** PP
DUF260 92 aelallkee 100
++la++++e
Potri.015G135900.1 92 SQLAKTRAE 100
****99987 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50891 | 24.377 | 1 | 101 | IPR004883 | Lateral organ boundaries, LOB |
| Pfam | PF03195 | 1.0E-40 | 1 | 98 | IPR004883 | Lateral organ boundaries, LOB |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 103 aa Download sequence Send to blast |
RCAACKYLRR RCPSDCIFSP YFPSNNPRRF ACVHRIHGAS NVAKMLQQLP AHLRAEAANS 60 LYYEAQCRTQ DPVYGCVGIL SLLHQQIHSV ESQLAKTRAE IA* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5ly0_A | 3e-37 | 2 | 101 | 12 | 111 | LOB family transfactor Ramosa2.1 |
| 5ly0_B | 3e-37 | 2 | 101 | 12 | 111 | LOB family transfactor Ramosa2.1 |
| Search in ModeBase | ||||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Potri.015G135900.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002318256.2 | 5e-67 | LOB domain-containing protein 24 | ||||
| Swissprot | P59468 | 7e-52 | LBD24_ARATH; LOB domain-containing protein 24 | ||||
| TrEMBL | A0A2K1XMJ7 | 3e-69 | A0A2K1XMJ7_POPTR; Uncharacterized protein (Fragment) | ||||
| STRING | POPTR_0015s13870.1 | 3e-70 | (Populus trichocarpa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF3697 | 30 | 66 | Representative plant | OGRP60 | 16 | 318 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G26660.1 | 3e-54 | LOB domain-containing protein 24 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Potri.015G135900.1 |
| Entrez Gene | 7476781 |




