![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Potri.016G085000.4 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 125aa MW: 13869.8 Da PI: 9.7637 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 76.3 | 4.6e-24 | 25 | 71 | 49 | 95 |
NF-YB 49 easdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95
+sdkcqrekrktingddllwa+atlGfedy++plk+yl++yre ++
Potri.016G085000.4 25 ATSDKCQREKRKTINGDDLLWAMATLGFEDYIDPLKIYLSRYREGDT 71
579****************************************9665 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF47113 | 3.07E-17 | 6 | 87 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 1.2E-4 | 22 | 47 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| Gene3D | G3DSA:1.10.20.10 | 2.2E-20 | 22 | 82 | IPR009072 | Histone-fold |
| PRINTS | PR00615 | 2.2E-10 | 30 | 48 | No hit | No description |
| PRINTS | PR00615 | 2.2E-10 | 49 | 67 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 125 aa Download sequence Send to blast |
MERLLRMLKR LFKNVFLSSL ALSLATSDKC QREKRKTING DDLLWAMATL GFEDYIDPLK 60 IYLSRYREGD TKGSAKTGDT SAKKDIHPGP NAQISHQGSF SQGVSYGNSN SQAPHMMVPM 120 QSNE* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4g91_B | 9e-17 | 26 | 68 | 50 | 92 | Transcription factor HapC (Eurofung) |
| 4g92_B | 9e-17 | 26 | 68 | 50 | 92 | Transcription factor HapC (Eurofung) |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in the whole plant, except roots. {ECO:0000269|PubMed:11867211}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Potri.016G085000.4 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002322853.1 | 5e-68 | nuclear transcription factor Y subunit B-10 isoform X2 | ||||
| Swissprot | Q67XJ2 | 5e-40 | NFYBA_ARATH; Nuclear transcription factor Y subunit B-10 | ||||
| TrEMBL | B9IIZ5 | 1e-66 | B9IIZ5_POPTR; Uncharacterized protein | ||||
| STRING | XP_006480596.1 | 5e-54 | (Citrus sinensis) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G53340.1 | 2e-41 | nuclear factor Y, subunit B10 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Potri.016G085000.4 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




