![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Potri.017G012900.1 | ||||||||
| Common Name | POPTR_0017s04460g | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
| Family | SBP | ||||||||
| Protein Properties | Length: 111aa MW: 12592.6 Da PI: 9.9532 | ||||||||
| Description | SBP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SBP | 29.9 | 1.5e-09 | 73 | 103 | 1 | 31 |
--SSTT-----TT--HHHHHTT--HHHHT-S CS
SBP 1 lCqvegCeadlseakeyhrrhkvCevhskap 31
+Cq+e+C +dl+ ak+yh++hkv e h+k +
Potri.017G012900.1 73 CCQIENCIVDLTYAKQYHNKHKVFEYHTKGS 103
6***************************965 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:4.10.1100.10 | 3.2E-9 | 67 | 101 | IPR004333 | Transcription factor, SBP-box |
| PROSITE profile | PS51141 | 10.203 | 71 | 110 | IPR004333 | Transcription factor, SBP-box |
| SuperFamily | SSF103612 | 4.71E-8 | 72 | 103 | IPR004333 | Transcription factor, SBP-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 111 aa Download sequence Send to blast |
MEGKLKQIRM VMGRVVIKKE SVNESSNDEG YKQNKVEFIK DEFFKRNRKK IMVVTSGCGS 60 GRKVSDGGGG MKCCQIENCI VDLTYAKQYH NKHKVFEYHT KGSGYACNWK * |
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Potri.017G012900.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC210656 | 0.0 | AC210656.1 Populus trichocarpa clone POP061-K03, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002309744.2 | 2e-17 | squamosa promoter-binding protein 1 | ||||
| Refseq | XP_011047666.1 | 6e-17 | PREDICTED: squamosa promoter-binding protein 2-like isoform X1 | ||||
| Refseq | XP_011047667.1 | 2e-17 | PREDICTED: squamosa promoter-binding protein 2-like isoform X2 | ||||
| TrEMBL | A0A2K1X1R4 | 2e-74 | A0A2K1X1R4_POPTR; Uncharacterized protein | ||||
| STRING | POPTR_0017s04460.1 | 2e-72 | (Populus trichocarpa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Representative plant | OGRP97 | 17 | 230 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G02065.1 | 6e-08 | squamosa promoter binding protein-like 8 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Potri.017G012900.1 |
| Entrez Gene | 18106778 |




