![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Potri.017G099500.1 | ||||||||
| Common Name | POPTR_0017s13370g | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
| Family | MYB | ||||||||
| Protein Properties | Length: 172aa MW: 20102.8 Da PI: 10.3994 | ||||||||
| Description | MYB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 65.3 | 1.1e-20 | 16 | 63 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g+WT+eEd+ll+++v ++G g+W++++r+ g++R++k+c++rw +yl
Potri.017G099500.1 16 KGPWTPEEDKLLIEYVSLHGEGRWSSVSRCPGLNRSGKSCRLRWVNYL 63
79********************************************97 PP
| |||||||
| 2 | Myb_DNA-binding | 53.3 | 6.3e-17 | 69 | 113 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
rg T++E+ ++++++++lG++ W+tIar+++ gRt++++k++w+++
Potri.017G099500.1 69 RGQITPQEEGIIIELHALLGNK-WSTIARYLP-GRTDNEIKNYWRTH 113
7888******************.*********.***********986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 24.078 | 11 | 67 | IPR017930 | Myb domain |
| SuperFamily | SSF46689 | 1.8E-32 | 13 | 110 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 1.2E-17 | 15 | 65 | IPR001005 | SANT/Myb domain |
| Pfam | PF00249 | 1.1E-18 | 16 | 63 | IPR001005 | SANT/Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 6.1E-24 | 17 | 70 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 1.44E-12 | 18 | 63 | No hit | No description |
| SMART | SM00717 | 1.7E-13 | 68 | 116 | IPR001005 | SANT/Myb domain |
| PROSITE profile | PS51294 | 19.74 | 68 | 118 | IPR017930 | Myb domain |
| Pfam | PF00249 | 1.1E-14 | 69 | 113 | IPR001005 | SANT/Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 1.1E-24 | 71 | 117 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 1.25E-9 | 73 | 113 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 172 aa Download sequence Send to blast |
MVARMGWGIP EKGWRKGPWT PEEDKLLIEY VSLHGEGRWS SVSRCPGLNR SGKSCRLRWV 60 NYLRPGLKRG QITPQEEGII IELHALLGNK WSTIARYLPG RTDNEIKNYW RTHSKKKEKS 120 SQKQLEKRKA QILKQEEEHQ QHLQQQQQQQ QQQLEAGDMN MVNTIAHENQ R* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1a5j_A | 1e-26 | 8 | 117 | 1 | 107 | B-MYB |
| 1h8a_C | 2e-26 | 16 | 117 | 27 | 127 | MYB TRANSFORMING PROTEIN |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: During seed development, gradually down-regulated towards the onset of ripening (veraison). During berry skin development, dramatic decrease to full repression at veraison, followed by a slight increase towards ripening. In flowers, barely detectable in stamens, at the interface of filaments and anthers. {ECO:0000269|PubMed:22018045}. | |||||
| Uniprot | TISSUE SPECIFICITY: Mainly expressed in leaves and seedlings, and to a lower extent, in roots, stems and inflorescences. Isoform MYB48-1, isoform MYB48-3 and isoform MYB48-4 are present in all of these organs, but isoform MYB48-2 is confined to leaves. {ECO:0000269|PubMed:16531467}. | |||||
| Uniprot | TISSUE SPECIFICITY: Mainly expressed in leaves and seedlings, and to a lower extent, in roots, stems and inflorescences. Isoform MYB59-1 and isoform MYB59-2 are present in roots, leaves, and seedlings, while the expression of isoform MYB59-3 and isoform MYB59-4 is confined to seedlings. {ECO:0000269|PubMed:16531467}. | |||||
| Uniprot | TISSUE SPECIFICITY: Restricted to stomatal guard cells. Mostly expressed in leaves, cotyledons, hypocotyls, seeds and ripened berry skins. {ECO:0000269|PubMed:22018045}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. {ECO:0000305}. | |||||
| UniProt | Transcription factor. {ECO:0000305}. | |||||
| UniProt | Transcription factor involved in the regulation of gene (e.g. drought-regulated and flavonoid biosynthetic genes) expression and stomatal movements leading to negative regulation of responses to drought and responses to other physiological stimuli (e.g. light). {ECO:0000269|PubMed:22018045}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Potri.017G099500.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By salicylic acid (SA). {ECO:0000269|PubMed:16463103}. | |||||
| UniProt | INDUCTION: Isoform MYB59-1 is induced by jasmonate (JA), salicylic acid (SA), gibberellic acid (GA), and ethylene. Also induced by cadmium (Cd). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:16531467}. | |||||
| UniProt | INDUCTION: Repressed by abscisic acid (ABA) and osmotic stress (salt stress). {ECO:0000269|PubMed:22018045}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006373393.2 | 1e-123 | transcription factor MYB48 | ||||
| Swissprot | B3VTV7 | 3e-48 | MYB60_VITVI; Transcription factor MYB60 | ||||
| Swissprot | Q4JL84 | 6e-49 | MYB59_ARATH; Transcription factor MYB59 | ||||
| Swissprot | Q9LX82 | 6e-49 | MYB48_ARATH; Transcription factor MYB48 | ||||
| TrEMBL | A0A2K1X5U4 | 1e-121 | A0A2K1X5U4_POPTR; Uncharacterized protein | ||||
| STRING | POPTR_0017s13370.1 | 1e-119 | (Populus trichocarpa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF1182 | 34 | 108 | Representative plant | OGRP5 | 17 | 1784 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G30210.1 | 6e-63 | myb domain protein 121 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Potri.017G099500.1 |
| Entrez Gene | 18107342 |




