![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Potri.017G106700.1 | ||||||||
| Common Name | POPTR_0017s14490g | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
| Family | bZIP | ||||||||
| Protein Properties | Length: 136aa MW: 15657.4 Da PI: 5.6043 | ||||||||
| Description | bZIP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | bZIP_1 | 47.3 | 4.6e-15 | 21 | 70 | 5 | 54 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54
+++rr+ +NRe+ArrsR RK++ ++eL v + +eN++L ++l++ ++
Potri.017G106700.1 21 RKQRRMVSNRESARRSRMRKQKHLDELWSQVVWFRNENHQLLDKLNHVSE 70
689*****************************************999765 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SMART | SM00338 | 2.9E-12 | 17 | 81 | IPR004827 | Basic-leucine zipper domain |
| PROSITE profile | PS50217 | 9.979 | 19 | 70 | IPR004827 | Basic-leucine zipper domain |
| SuperFamily | SSF57959 | 1.48E-13 | 21 | 70 | No hit | No description |
| Gene3D | G3DSA:1.20.5.170 | 7.3E-12 | 21 | 93 | No hit | No description |
| Pfam | PF00170 | 7.3E-13 | 21 | 70 | IPR004827 | Basic-leucine zipper domain |
| CDD | cd14702 | 1.78E-16 | 22 | 73 | No hit | No description |
| PROSITE pattern | PS00036 | 0 | 24 | 39 | IPR004827 | Basic-leucine zipper domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0042803 | Molecular Function | protein homodimerization activity | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 136 aa Download sequence Send to blast |
MSSISTSDEA DEQQLSLINE RKQRRMVSNR ESARRSRMRK QKHLDELWSQ VVWFRNENHQ 60 LLDKLNHVSE CHDRVVHENA QLKEETSGLR QILTDMQLNS PYPLLKDLED ITCDTAYLGS 120 ESSNQSITSS SDLLG* |
| Nucleic Localization Signal ? help Back to Top | |||
|---|---|---|---|
| No. | Start | End | Sequence |
| 1 | 33 | 40 | RRSRMRKQ |
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcription factor involved in somatic embryogenesis. Acts as positive regulator of BHLH109. {ECO:0000269|PubMed:26973252}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00389 | DAP | Transfer from AT3G30530 | Download |
| |||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Potri.017G106700.1 |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC210139 | 1e-134 | AC210139.1 Populus trichocarpa clone POP113-I04, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_006373522.1 | 5e-95 | basic leucine zipper 43 | ||||
| Swissprot | Q9FMC2 | 4e-41 | BZP43_ARATH; Basic leucine zipper 43 | ||||
| TrEMBL | A0A2K1X666 | 2e-93 | A0A2K1X666_POPTR; Uncharacterized protein | ||||
| STRING | POPTR_0017s14490.1 | 2e-94 | (Populus trichocarpa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF1604 | 33 | 99 | Representative plant | OGRP3104 | 11 | 29 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G30530.1 | 6e-51 | basic leucine-zipper 42 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Potri.017G106700.1 |
| Entrez Gene | 18107453 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




