PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Potri.019G073600.1
Common NamePOPTR_0019s10225g, POPTR_0019s10260g
Organism
Populus trichocarpa
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family SBP
Protein Properties Length: 70aa    MW: 8351.57 Da    PI: 11.2142
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Potri.019G073600.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP45.61.9e-142364478
                        TTTSSEEETTT--SS--S-STTTT-------S--- CS
                 SBP 44 qqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78
                        q   rf elsefD++krsCrrrL+ hn+rrrk+q+
  Potri.019G073600.1  2 QNLFRFRELSEFDDKKRSCRRRLSYHNARRRKPQP 36
                        55679***************************997 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5114113.537134IPR004333Transcription factor, SBP-box
Gene3DG3DSA:4.10.1100.104.4E-4221IPR004333Transcription factor, SBP-box
PfamPF031105.7E-8433IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.53E-11540IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 70 aa     Download sequence    Send to blast
MQNLFRFREL SEFDDKKRSC RRRLSYHNAR RRKPQPEAIW FSSARPSSSF YGACFNFKGF  60
NCRVPKIID*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11532KKRSCRRRLSYHNARRRK
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Expressed in young panicles. {ECO:0000269|PubMed:16861571}.
UniprotTISSUE SPECIFICITY: Expressed in young panicles. {ECO:0000269|PubMed:16861571}.
Functional Description ? help Back to Top
Source Description
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
UniProtTrans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' (By similarity). May be involved in panicle development. {ECO:0000250}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapPotri.019G073600.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Negatively regulated by microRNAs miR156b and miR156h. {ECO:0000305|PubMed:16861571}.
UniProtINDUCTION: Negatively regulated by microRNAs miR156b and miR156h. {ECO:0000305|PubMed:16861571}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2130881e-114AC213088.1 Populus trichocarpa clone POP086-B14, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011014592.15e-18PREDICTED: squamosa promoter-binding-like protein 12 isoform X3
RefseqXP_011017580.15e-18PREDICTED: squamosa promoter-binding-like protein 12 isoform X3
RefseqXP_024446071.15e-18squamosa promoter-binding-like protein 12 isoform X3
SwissprotA2YGR54e-15SPL12_ORYSI; Squamosa promoter-binding-like protein 12
SwissprotQ5Z8185e-15SPL12_ORYSJ; Squamosa promoter-binding-like protein 12
TrEMBLB9IQA55e-43B9IQA5_POPTR; Uncharacterized protein
STRINGPOPTR_0019s10260.18e-44(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9717230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G57920.12e-13squamosa promoter binding protein-like 15
Publications ? help Back to Top
  1. Kikuchi S, et al.
    Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
    Science, 2003. 301(5631): p. 376-9
    [PMID:12869764]
  2. Liu Q, et al.
    The alteration in the architecture of a T-DNA insertion rice mutant osmtd1 is caused by up-regulation of MicroRNA156f.
    J Integr Plant Biol, 2015. 57(10): p. 819-29
    [PMID:25677853]