![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Potri.T105400.1 | ||||||||
| Common Name | POPTR_0017s02220g | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
| Family | G2-like | ||||||||
| Protein Properties | Length: 180aa MW: 19544.3 Da PI: 5.5295 | ||||||||
| Description | G2-like family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | G2-like | 72 | 8.5e-23 | 1 | 41 | 15 | 55 |
G2-like 15 veaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
v+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
Potri.T105400.1 1 VHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 41
89**************************************7 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.10.60 | 6.8E-19 | 1 | 41 | IPR009057 | Homeodomain-like |
| SuperFamily | SSF46689 | 7.35E-8 | 1 | 42 | IPR009057 | Homeodomain-like |
| TIGRFAMs | TIGR01557 | 5.9E-16 | 1 | 41 | IPR006447 | Myb domain, plants |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 180 aa Download sequence Send to blast |
VHAVELLGGH ERATPKSVLE LMDVKDLTLA HVKSHLQMYR TVKTTDKPAA SSDGSGEEDM 60 APIASFRTAN EQGGLQRAVQ ADGSTAQQDM DYPSTTTSAA TTLWSNSSSG REAWPQTNSN 120 DIDGHRQGTF QSQQRSGHQM EECNSTQLKS YLGSSNMDCK NPSLEFTLGR PDWQGKEHC* |
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: In globular embryos, expressed in the peripheral cells in a basal region above the hypophysis. In heart-stage embryos, expressed in the periphery of the presumptive hypocotyl and on the abaxial side of cotyledon primordia. During vegetative growth, expressed the abaxial side of very young leaf primordia. Expressed on the abaxial side of carpel primordia and then in a localized region on the abaxial margin that gives rise to the septum. Later, expressed in the tissue that gives rise to ovules. {ECO:0000269|PubMed:11525739}. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in developing phloem and lateral root. {ECO:0000269|PubMed:11525739, ECO:0000269|PubMed:14561401, ECO:0000269|PubMed:15286295}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcriptional repressor that regulates lateral organ polarity. Promotes lateral organ abaxial identity by repressing the adaxial regulator ASYMMETRIC LEAVES2 (AS2) in abaxial cells. Required for abaxial identity in both leaves and carpels. Functions with KAN2 in the specification of polarity of the ovule outer integument. Regulates cambium activity by repressing the auxin efflux carrier PIN1. Plays a role in lateral root formation and development. {ECO:0000269|PubMed:11395775, ECO:0000269|PubMed:11525739, ECO:0000269|PubMed:14561401, ECO:0000269|PubMed:15286295, ECO:0000269|PubMed:16623911, ECO:0000269|PubMed:17307928, ECO:0000269|PubMed:18849474, ECO:0000269|PubMed:20179097}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Potri.T105400.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Repressed by AS2 in adaxial tissue. {ECO:0000269|PubMed:18849474}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | AC214214 | 2e-86 | AC214214.1 Populus trichocarpa clone POP028-A01, complete sequence. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_024448674.1 | 1e-132 | transcription repressor KAN1 | ||||
| Swissprot | Q93WJ9 | 6e-51 | KAN1_ARATH; Transcription repressor KAN1 | ||||
| TrEMBL | A0A2K1X7N1 | 1e-125 | A0A2K1X7N1_POPTR; Uncharacterized protein | ||||
| STRING | POPTR_0017s02220.1 | 1e-127 | (Populus trichocarpa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF1756 | 33 | 91 | Representative plant | OGRP570 | 15 | 80 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT5G16560.1 | 4e-49 | G2-like family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Potri.T105400.1 |
| Entrez Gene | 18106569 |




