![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Potri.T127400.1 | ||||||||
| Common Name | POPTR_0011s13460g | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
|
||||||||
| Family | GRAS | ||||||||
| Protein Properties | Length: 108aa MW: 12613.5 Da PI: 8.3291 | ||||||||
| Description | GRAS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | GRAS | 123.6 | 2.4e-38 | 1 | 106 | 267 | 373 |
GRAS 267 lfdsleaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvl 360
+f+s+++ lpr+++eri+vE+++l+r+ivnv+aceg+er+erhe ++kW++r+++aGF++ pls+++++ +++llr ++ + y++ e +g+++l
Potri.T127400.1 1 MFESIDVRLPRNQKERISVEQHCLARDIVNVIACEGKEREERHELFGKWKSRFMMAGFRQCPLSSYVNSVIRSLLRCYS-EHYTLVEIDGAMLL 93
7**************************************************************************9999.66************ PP
GRAS 361 gWkdrpLvsvSaW 373
gWkdr+L+s+SaW
Potri.T127400.1 94 GWKDRNLISASAW 106
************* PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50985 | 18.11 | 1 | 88 | IPR005202 | Transcription factor GRAS |
| Pfam | PF03514 | 8.1E-36 | 1 | 106 | IPR005202 | Transcription factor GRAS |
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 108 aa Download sequence Send to blast |
MFESIDVRLP RNQKERISVE QHCLARDIVN VIACEGKERE ERHELFGKWK SRFMMAGFRQ 60 CPLSSYVNSV IRSLLRCYSE HYTLVEIDGA MLLGWKDRNL ISASAWY* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5b3h_A | 7e-13 | 1 | 106 | 272 | 377 | Protein SCARECROW |
| 5b3h_D | 7e-13 | 1 | 106 | 272 | 377 | Protein SCARECROW |
| Search in ModeBase | ||||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | May play a regulatory role in the early step of oligosaccharide elicitor response, downstream of the membrane-associated high-affinity chitin-binding protein. {ECO:0000269|PubMed:12591613}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Potri.T127400.1 |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: By oligosaccharide elicitor (N-Acetylchitooligosaccharide) extracted from the rice blast fungus (M.grisea) cell wall. Strongest induction by chitin oligomer with greater degree of polymerization (heptamer). By inoculation of M.grisea in rice cell suspension culture. {ECO:0000269|PubMed:12591613}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_002317558.1 | 3e-72 | scarecrow-like protein 21 isoform X1 | ||||
| Refseq | XP_024437244.1 | 3e-72 | scarecrow-like protein 21 isoform X2 | ||||
| Refseq | XP_024437245.1 | 4e-73 | chitin-inducible gibberellin-responsive protein 1 isoform X3 | ||||
| Swissprot | Q69VG1 | 5e-55 | CIGR1_ORYSJ; Chitin-inducible gibberellin-responsive protein 1 | ||||
| TrEMBL | A0A2K1R5T7 | 4e-74 | A0A2K1R5T7_POPTR; Uncharacterized protein | ||||
| TrEMBL | A0A3N7FV79 | 1e-71 | A0A3N7FV79_POPTR; Uncharacterized protein | ||||
| TrEMBL | B9I072 | 7e-71 | B9I072_POPTR; Uncharacterized protein | ||||
| STRING | POPTR_0011s13460.1 | 1e-71 | (Populus trichocarpa) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF36930 | 2 | 2 | Representative plant | OGRP14896 | 4 | 4 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G04890.1 | 1e-48 | SCARECROW-like 21 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Potri.T127400.1 |
| Entrez Gene | 7470916 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




