![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Pp3c16_12230V3.2.p | ||||||||
| Common Name | PHYPADRAFT_235404, PPML1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
|
||||||||
| Family | M-type_MADS | ||||||||
| Protein Properties | Length: 51aa MW: 5828.02 Da PI: 9.7544 | ||||||||
| Description | M-type_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 41.2 | 2.1e-13 | 11 | 47 | 3 | 39 |
--SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEE CS
SRF-TF 3 ienksnrqvtfskRrngilKKAeELSvLCdaevavii 39
i+n+ +++++s R + +lKK +ELS+LC +e a+i+
Pp3c16_12230V3.2.p 11 IKNDAFQTTSYSMRMKKLLKKVNELSILCKIEMAIIY 47
99**********************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF55455 | 4.19E-9 | 10 | 47 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 3.1E-10 | 11 | 47 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS50066 | 10.274 | 11 | 50 | IPR002100 | Transcription factor, MADS-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 51 aa Download sequence Send to blast |
MLVIFNIGPH IKNDAFQTTS YSMRMKKLLK KVNELSILCK IEMAIIYDHS * |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| TrEMBL | A9RLA2 | 1e-28 | A9RLA2_PHYPA; MADS-like MADS-domain protein PPML1 | ||||
| STRING | PP1S15_307V6.1 | 2e-29 | (Physcomitrella patens) | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Pp3c16_12230V3.2.p |
| Entrez Gene | 5918212 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




