![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Pp3c27_7510V3.2.p | ||||||||
| Common Name | PHYPADRAFT_140223 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 161aa MW: 18119.7 Da PI: 10.3831 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 169.4 | 1.1e-52 | 15 | 143 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92
lppGfrFhPtdeelv +yL +k+e+ ++++ vi+e+d+yk++PwdLp k+ +e ewyfFs+rd+ky++g r+nra++sg+Wkatg+d++v
Pp3c27_7510V3.2.p 15 LPPGFRFHPTDEELVLHYLWRKTESATFSI-PVITELDLYKYDPWDLPGKAILGEGEWYFFSPRDRKYPNGARPNRAAASGFWKATGTDRPV 105
79***************************9.89***************76667889************************************ PP
NAM 93 lsk..kgelvglkktLvfykgrapkgektdWvmheyrl 128
+++ + +++g+kk Lvfykgrapkg+kt+Wvmheyrl
Pp3c27_7510V3.2.p 106 HTSrgTLQKIGVKKALVFYKGRAPKGVKTTWVMHEYRL 143
*99555567***************************98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| SuperFamily | SSF101941 | 1.2E-58 | 9 | 148 | IPR003441 | NAC domain |
| PROSITE profile | PS51005 | 54.723 | 15 | 161 | IPR003441 | NAC domain |
| Pfam | PF02365 | 1.2E-27 | 16 | 143 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 161 aa Download sequence Send to blast |
MASSSGVPVI PQIELPPGFR FHPTDEELVL HYLWRKTESA TFSIPVITEL DLYKYDPWDL 60 PGKAILGEGE WYFFSPRDRK YPNGARPNRA AASGFWKATG TDRPVHTSRG TLQKIGVKKA 120 LVFYKGRAPK GVKTTWVMHE YRLADGISPS SNTTRKPGSL R |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ut4_A | 3e-64 | 10 | 161 | 12 | 153 | NO APICAL MERISTEM PROTEIN |
| 1ut4_B | 3e-64 | 10 | 161 | 12 | 153 | NO APICAL MERISTEM PROTEIN |
| 1ut7_A | 3e-64 | 10 | 161 | 12 | 153 | NO APICAL MERISTEM PROTEIN |
| 1ut7_B | 3e-64 | 10 | 161 | 12 | 153 | NO APICAL MERISTEM PROTEIN |
| 3swm_A | 3e-64 | 10 | 161 | 15 | 156 | NAC domain-containing protein 19 |
| 3swm_B | 3e-64 | 10 | 161 | 15 | 156 | NAC domain-containing protein 19 |
| 3swm_C | 3e-64 | 10 | 161 | 15 | 156 | NAC domain-containing protein 19 |
| 3swm_D | 3e-64 | 10 | 161 | 15 | 156 | NAC domain-containing protein 19 |
| 3swp_A | 3e-64 | 10 | 161 | 15 | 156 | NAC domain-containing protein 19 |
| 3swp_B | 3e-64 | 10 | 161 | 15 | 156 | NAC domain-containing protein 19 |
| 3swp_C | 3e-64 | 10 | 161 | 15 | 156 | NAC domain-containing protein 19 |
| 3swp_D | 3e-64 | 10 | 161 | 15 | 156 | NAC domain-containing protein 19 |
| 4dul_A | 3e-64 | 10 | 161 | 12 | 153 | NAC domain-containing protein 19 |
| 4dul_B | 3e-64 | 10 | 161 | 12 | 153 | NAC domain-containing protein 19 |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: Up-regulated during anther and flower development and leaf senescence. {ECO:0000269|PubMed:22278768}. | |||||
| Uniprot | TISSUE SPECIFICITY: Highest expression in stamens. Expressed in leaves. {ECO:0000269|PubMed:18813954, ECO:0000269|PubMed:22278768}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor of the NAC family associated with male fertility. Involved in anther development, but not in senescence. Reduced expression of NAC5 via RNAi leads to male-sterility. {ECO:0000269|PubMed:22278768}. | |||||
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Up-regulated by drought, salt and cold treatments. {ECO:0000269|PubMed:18813954}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_024367540.1 | 1e-115 | NAC transcription factor 25-like | ||||
| Refseq | XP_024367541.1 | 1e-115 | NAC transcription factor 25-like | ||||
| Refseq | XP_024367542.1 | 1e-115 | NAC transcription factor 25-like | ||||
| Refseq | XP_024367544.1 | 1e-115 | NAC transcription factor 25-like | ||||
| Refseq | XP_024367545.1 | 1e-115 | NAC transcription factor 25-like | ||||
| Refseq | XP_024367546.1 | 1e-115 | NAC transcription factor 25-like | ||||
| Refseq | XP_024367547.1 | 1e-115 | NAC transcription factor 25-like | ||||
| Refseq | XP_024367548.1 | 1e-115 | NAC transcription factor 25-like | ||||
| Refseq | XP_024367549.1 | 1e-115 | NAC transcription factor 25-like | ||||
| Refseq | XP_024367550.1 | 1e-115 | NAC transcription factor 25-like | ||||
| Refseq | XP_024367551.1 | 1e-115 | NAC transcription factor 25-like | ||||
| Refseq | XP_024367552.1 | 1e-115 | NAC transcription factor 25-like | ||||
| Swissprot | Q8H4S4 | 2e-70 | NAC10_ORYSJ; NAC domain-containing protein 10 | ||||
| TrEMBL | A0A2K1IB21 | 1e-114 | A0A2K1IB21_PHYPA; Uncharacterized protein | ||||
| TrEMBL | A9T4L6 | 1e-114 | A9T4L6_PHYPA; Predicted protein | ||||
| STRING | PP1S164_33V6.1 | 1e-114 | (Physcomitrella patens) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G04070.2 | 5e-71 | NAC domain containing protein 47 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Pp3c27_7510V3.2.p |
| Entrez Gene | 5936776 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




