![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Prupe.1G138500.1.p | ||||||||
| Common Name | PRUPE_ppa015692mg | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 164aa MW: 18552.4 Da PI: 5.695 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 162 | 8.4e-51 | 24 | 120 | 1 | 97 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91
++eq+++lPianv+rim+++lP nakisk+aket+qecvsefisfvtseas+kc++e+rkt+ngdd+ wal+ lGfedy pl+ +l++yr
Prupe.1G138500.1.p 24 MKEQEQLLPIANVGRIMRQILPPNAKISKEAKETMQECVSEFISFVTSEASEKCRKERRKTVNGDDVSWALGALGFEDYTGPLRRFLHRYR 114
589**************************************************************************************** PP
NF-YB 92 elegek 97
e ege+
Prupe.1G138500.1.p 115 EQEGER 120
***986 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 5.4E-51 | 19 | 149 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 1.07E-38 | 27 | 146 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 1.6E-27 | 30 | 94 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 7.4E-16 | 58 | 76 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 61 | 77 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 7.4E-16 | 77 | 95 | No hit | No description |
| PRINTS | PR00615 | 7.4E-16 | 96 | 114 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 164 aa Download sequence Send to blast |
MVDNNNNNIG ASGAANHDED GAMMKEQEQL LPIANVGRIM RQILPPNAKI SKEAKETMQE 60 CVSEFISFVT SEASEKCRKE RRKTVNGDDV SWALGALGFE DYTGPLRRFL HRYREQEGER 120 ISSSAANNNN NNNENNQDKD NNNPEDQQQR KLLNHPHIQR PNF* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4g91_B | 4e-42 | 24 | 115 | 1 | 92 | Transcription factor HapC (Eurofung) |
| 4g92_B | 4e-42 | 24 | 115 | 1 | 92 | Transcription factor HapC (Eurofung) |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in flowers and siliques. {ECO:0000269|PubMed:11250072}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Prupe.1G138500.1.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_007224115.1 | 1e-119 | nuclear transcription factor Y subunit B-1 | ||||
| Swissprot | O82248 | 6e-52 | NFYB5_ARATH; Nuclear transcription factor Y subunit B-5 | ||||
| TrEMBL | M5XH85 | 1e-117 | M5XH85_PRUPE; Uncharacterized protein | ||||
| STRING | EMJ25314 | 1e-118 | (Prunus persica) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF805 | 32 | 131 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G47810.1 | 1e-53 | nuclear factor Y, subunit B5 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Prupe.1G138500.1.p |
| Entrez Gene | 18790297 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




