![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Prupe.1G271100.4.p | ||||||||
| Common Name | PRUPE_ppa017536mg | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
|
||||||||
| Family | MYB | ||||||||
| Protein Properties | Length: 451aa MW: 50858.5 Da PI: 5.6209 | ||||||||
| Description | MYB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 44 | 5.1e-14 | 26 | 70 | 3 | 48 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
W++eEd++l + + +G+++W+ Ia+++ +t qc+ rw++yl
Prupe.1G271100.4.p 26 TWSQEEDDILRNQISVHGTDNWAIIASKFK-DKTTRQCRRRWYTYL 70
6****************************9.*************97 PP
| |||||||
| 2 | Myb_DNA-binding | 43.7 | 6.1e-14 | 76 | 119 | 1 | 46 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
+g W++eEd ll +a k +G++ W+ Ia+ + gRt++ +k+r+ +
Prupe.1G271100.4.p 76 KGGWSPEEDMLLCEAQKIFGNR-WTEIAKVVS-GRTDNAVKNRFST 119
688*******************.*********.**********976 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 15.803 | 19 | 70 | IPR017930 | Myb domain |
| SuperFamily | SSF46689 | 6.74E-26 | 23 | 117 | IPR009057 | Homeodomain-like |
| SMART | SM00717 | 4.7E-13 | 23 | 72 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 1.82E-12 | 26 | 70 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 2.9E-20 | 27 | 78 | IPR009057 | Homeodomain-like |
| Pfam | PF13921 | 1.6E-15 | 27 | 87 | No hit | No description |
| PROSITE profile | PS51294 | 20.055 | 71 | 125 | IPR017930 | Myb domain |
| SMART | SM00717 | 1.1E-14 | 75 | 123 | IPR001005 | SANT/Myb domain |
| CDD | cd00167 | 1.82E-10 | 79 | 120 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 4.9E-19 | 79 | 124 | IPR009057 | Homeodomain-like |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0009553 | Biological Process | embryo sac development | ||||
| GO:0010052 | Biological Process | guard cell differentiation | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 451 aa Download sequence Send to blast |
MPQEEPRKKL GNEYSNSKKK ERHIVTWSQE EDDILRNQIS VHGTDNWAII ASKFKDKTTR 60 QCRRRWYTYL NSDFKKGGWS PEEDMLLCEA QKIFGNRWTE IAKVVSGRTD NAVKNRFSTL 120 CKKRAKYEAL AKENASSYIN SNDKRVIIRN GFNTDGTTET TVPSKKMRRT HIPNLPENCN 180 SGDRLFEQCG KMNQQLRAPF TVLIQNFHNV DNLPDQHNVS STKEVPGNAA QNSKFQGSFL 240 KKDDPKITAL MQQAELLSSL ALKVNTENTD QSLENAWKVL QDFLNQSKES DILSYGITDF 300 DFQLEDLKYL LEDLRSTNEG SRPSWQQPDL YDESPGRSEY STGSTLLSQT ECYVEQNEAD 360 IGTLIEEIQP GSQSIPIGGE NDVRECEKGI VSSGTRKQEI FPSCNEGTKT DAVISVSSNT 420 EFSSPNQVTP LFRSLAAGIP SPKFSESKDA * |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1a5j_A | 3e-26 | 27 | 125 | 10 | 108 | B-MYB |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: Accumulates during ovule development. Detected at low levels in ovules and in the embryo sac of stage 13 flowers (PubMed:22915737). Not detected during embryo development. In seedlings and young plants, present in some spots (presumably stomata) in cotyledons and later in veins of hypocotyls as well as of petioles, hydathodes, stipules, in roots and lateral root primordia, and in the lower halves of first leaves. Detected in the phloem, as well as in the cortex of inflorescence stems. In roots, confined in developing xylem cells in the part of the differentiation zone with well-developed root hairs (PubMed:26391711). Present in lateral root tips and subsequently in a larger area. Accumulates in columella cells of lateral roots (PubMed:26578169). Expressed at the base of developing flowers, including ovaries. In flowers, detected in parts of the major stem axis, and in the anther at some stages of development, present in veins of sepals and accumulates progressively in ovaries, filaments, receptacles, and ovules. Also detected in the valve margins and receptacles of siliques and at the joint between the stigma and the style, as well as in the tapetum around pollen grains in maturing anthers (PubMed:26391711). {ECO:0000269|PubMed:22915737, ECO:0000269|PubMed:26391711, ECO:0000269|PubMed:26578169}. | |||||
| Uniprot | DEVELOPMENTAL STAGE: Expressed at the transition to terminal stomatal differentiation, just before and after the symmetric division of stomatal differentiation, being confined to late-stage guard mother cells (GMC) and to young, still differentiating guard cells (PubMed:16155180, PubMed:24571519). Detected in unopened flower buds, at the bases of sepals, petals, and stamens and in the receptacle of carpels, as well as both in style and stigma. Present at strong levels in the placenta within the ovary. Accumulates during ovule development in a dynamic pattern; first observed at high levels in the funiculus once integument outgrowth has begun and persists into later stages. Also expressed in the nucellus of younger ovules, especially in the megaspore mother cell (MMC) and in epidermal cells. Present in integuments, in the endothelial layer and the outer layer of the outer integument, which will form the mucilage-containing seed coat cells (PubMed:22915737). In developing embryos, first detected in cells in the ground tissue meristem at the early heart stage accumulates in the torpedo stage. In mature embryos, expressed in the embryonic hypocotyl and root tip. In seedlings, present first in the lower part of the hypocotyl and in the root tip, and later in petioles of cotyledons, young leaves, and lateral root primordia, near the pericycle. In young plants, strongly expressed in petioles of young leaves and cotyledons, especially in veins, in the basal part of young first leaves and cotyledons, and in root tips of lateral roots. Detected in the phloem, as well as in the cortex of inflorescence stems (PubMed:26391711). In roots, present in the root tip in columella cells, specifically in the lower tier of columella cells, as well as in developing metaxylem (PubMed:26391711, PubMed:26578169). Widely expressed in freshly emerged lateral roots. In elongating lateral roots, confined at high levels transiently in columella cells until differentiation (PubMed:26578169). Expressed at the base of developing flowers, including ovaries. In flowers, detected in ovaries, receptacles, and transiently, in anthers, and, later, in filaments. Also detected in the valve margins and receptacles of siliques and at the joint between the stigma and the style, as well as in the tapetum around pollen grains in maturing anthers (PubMed:26391711). {ECO:0000269|PubMed:16155180, ECO:0000269|PubMed:22915737, ECO:0000269|PubMed:24571519, ECO:0000269|PubMed:26391711, ECO:0000269|PubMed:26578169}. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed at low levels in all organs including roots, leaves, hypocotyls stems, flowers, siliques and buds. {ECO:0000269|PubMed:16155180, ECO:0000269|PubMed:26391711}. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in all shoot organs with higher levels in leaves, stems, flowers, siliques and floral buds. Also detected in roots tips. {ECO:0000269|PubMed:16155180, ECO:0000269|PubMed:26391711}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor that binds to DNA in promoters cis-regulatory element 5'-GGCGCGC-3' of cell cycle genes, including cyclins, cyclin-dependent kinases (CDKs), and components of the pre-replication complex (PubMed:20675570, PubMed:24687979). Binds to DNA in promoters cis-regulatory element 5'-AGCCG-3' of auxin regulated genes (e.g. PIN3 and PIN7) (PubMed:26578169). Together with FAMA and MYB124, ensures that stomata contain just two guard cells (GCs) by enforcing a single symmetric precursor cell division before stomatal maturity (PubMed:24571519). Represses the expression of the mitosis-inducing factors CDKB1-1 and CDKA-1, specifically required for the last guard mother cells (GMC) symmetric divisions in the stomatal pathway (PubMed:20675570, PubMed:24687979). Represses CYCA2-3 in newly formed guard cells (PubMed:21772250). Together with MYB88, regulates stomata spacing by restricting divisions late in the stomatal cell lineage thus limiting the number of GMC divisions (PubMed:16155180). In collaboration with CDKB1-1 and CDKB1-2, restrict the G1/S transition and chloroplast and nuclear number during stomatal formation, and normally maintain fate and developmental progression throughout the stomatal cell lineage (PubMed:24123248). Involved in sensing and/or transducing abiotic stress (e.g. drought and salt), probably via the positive regulation of NAC019 (PubMed:21105921). Regulates female reproduction being required for entry into megasporogenesis, probably via the regulation of cell cycle genes (PubMed:22915737). Plays a minor role in lateral roots (LRs) initiation (PubMed:26578065). Involved complementarily in establishing the gravitropic set-point angles of lateral roots by regulating the transcription of PIN3 and PIN7 in gravity-sensing cells of primary and lateral roots (PubMed:26578169). {ECO:0000269|PubMed:16155180, ECO:0000269|PubMed:20675570, ECO:0000269|PubMed:21105921, ECO:0000269|PubMed:21772250, ECO:0000269|PubMed:22915737, ECO:0000269|PubMed:24123248, ECO:0000269|PubMed:24571519, ECO:0000269|PubMed:24687979, ECO:0000269|PubMed:26578065, ECO:0000269|PubMed:26578169}. | |||||
| UniProt | Transcription factor that binds to DNA in promoters cis-regulatory element 5'-GGCGCGC-3' of cell cycle genes, including cyclins, cyclin-dependent kinases (CDKs), and components of the pre-replication complex (PubMed:20675570, PubMed:24687979). Binds to DNA in promoters cis-regulatory element 5'-AGCCG-3' of auxin regulated genes (e.g. PIN3 and PIN7) (PubMed:26578169). Together with FAMA and MYB88, ensures that stomata contain just two guard cells (GCs) by enforcing a single symmetric precursor cell division before stomatal maturity (PubMed:24571519). Represses the expression of the mitosis-inducing factors CDKB1-1 and CDKA-1, specifically required for the last guard mother cells (GMC) symmetric divisions in the stomatal pathway (PubMed:20675570, PubMed:24687979). Represses CYCA2-3 in newly formed guard cells (PubMed:21772250). Together with MYB88, regulates stomata spacing by restricting divisions late in the stomatal cell lineage thus limiting the number of GMC divisions (PubMed:11536724, PubMed:9684356, PubMed:16155180, PubMed:24123248). In collaboration with CDKB1-1 and CDKB1-2, restrict the G1/S transition and chloroplast and nuclear number during stomatal formation, and normally maintain fate and developmental progression throughout the stomatal cell lineage (PubMed:24123248). Also involved in the shape regulation of pavement cells (PubMed:9684356). Involved in sensing and/or transducing abiotic stress (e.g. drought and salt), probably via the positive regulation of NAC019 (PubMed:21105921). Regulates female reproduction being required for entry into megasporogenesis, probably via the regulation of cell cycle genes (PubMed:22915737). Promotes histone H3K27me3 marks and represses stem cell gene expression (PubMed:24654956). Required for lateral roots (LRs) initiation via the regulation of PIN3 expression in an auxin-dependent manner (PubMed:26578065). Involved in responses to gravity stimulation in primary roots by regulating the transcription of PIN3 and PIN7 in gravity-sensing cells, thus modulating auxin asymmetric redistribution (PubMed:26578169). {ECO:0000269|PubMed:11536724, ECO:0000269|PubMed:16155180, ECO:0000269|PubMed:20675570, ECO:0000269|PubMed:21105921, ECO:0000269|PubMed:21772250, ECO:0000269|PubMed:22915737, ECO:0000269|PubMed:24123248, ECO:0000269|PubMed:24571519, ECO:0000269|PubMed:24654956, ECO:0000269|PubMed:24687979, ECO:0000269|PubMed:26578065, ECO:0000269|PubMed:26578169, ECO:0000269|PubMed:9684356}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00259 | DAP | Transfer from AT2G02820 | Download |
| |||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Prupe.1G271100.4.p |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Strongly induced by auxin in a IAA14/SLR1 and ARF7 dependent manner, especially in xylem pole pericycle cells, lateral roots initiating cells. {ECO:0000269|PubMed:26578065}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020410891.1 | 0.0 | transcription factor MYB124 isoform X1 | ||||
| Swissprot | F4IRB4 | 1e-159 | MYB88_ARATH; Transcription factor MYB88 | ||||
| Swissprot | Q94FL6 | 1e-160 | MY124_ARATH; Transcription factor MYB124 | ||||
| TrEMBL | A0A251R3Y5 | 0.0 | A0A251R3Y5_PRUPE; Uncharacterized protein | ||||
| STRING | EMJ28482 | 0.0 | (Prunus persica) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G02820.1 | 1e-163 | myb domain protein 88 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Prupe.1G271100.4.p |
| Entrez Gene | 18789067 |




