PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Prupe.1G323400.1.p

Common Name

MYB18, PRUPE_ppa010846mg

Organism

Prunus persica

Taxonomic ID

3760

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus

Family

MYB

Protein Properties

Length: 234aa MW: 26383.9 Da PI: 8.8232

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Prupe.1G323400.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	54.6	2.6e-17	13	60	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+W+++Ed++l+d+++++G g+W+t ++ g+ R++k+c++rw +yl Prupe.1G323400.1.p 13 RGAWSKQEDLKLIDYIRKHGEGCWRTLPQAAGLLRCGKSCRLRWINYL 60 89****************************99**********97 PP
2	Myb_DNA-binding	52.8	9e-17	66	111	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg++ ++E++l+v+++++lG++ W++Ia +++ gRt++++k++w+++l Prupe.1G323400.1.p 66 RGNFAEDEEDLIVKLHALLGNR-WSLIAGRLP-GRTDNEVKNYWNSHL 111 8999****************.*****.**********986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	4.6E-23	4	63	IPR009057	Homeodomain-like
PROSITE profile	PS51294	16.294	8	60	IPR017930	Myb domain
SuperFamily	SSF46689	8.44E-28	11	107	IPR009057	Homeodomain-like
SMART	SM00717	5.5E-13	12	62	IPR001005	SANT/Myb domain
Pfam	PF00249	2.3E-15	13	60	IPR001005	SANT/Myb domain
CDD	cd00167	1.53E-10	15	60	No hit	No description
PROSITE profile	PS51294	26.742	61	115	IPR017930	Myb domain
Gene3D	G3DSA:1.10.10.60	1.2E-25	64	116	IPR009057	Homeodomain-like
SMART	SM00717	1.8E-15	65	113	IPR001005	SANT/Myb domain
Pfam	PF00249	4.7E-15	66	111	IPR001005	SANT/Myb domain
CDD	cd00167	3.19E-11	68	111	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 234 aa Download sequence Send to blast
MRKPCCDKQD TNRGAWSKQE DLKLIDYIRK HGEGCWRTLP QAAGLLRCGK SCRLRWINYL 60 RPDLKRGNFA EDEEDLIVKL HALLGNRWSL IAGRLPGRTD NEVKNYWNSH LRRKLISMGI 120 DPNNHRPNTF NLPRPHHKNS QAISSTAKLS AGLKTPTNDQ PARSGGNNCD QVSDGTSCLE 180 DESCGHQLPD LNLDLTMTAP LSNSEPENLK EEQNLMSLKC HRNLPRPPIS FLS*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	7e-28	10	115	4	108	B-MYB
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Widely expressed at low level. Highly expressed in siliques. Weakly expressed in seedlings, young and mature leaves, cauline leaves, stems, flower buds and roots. {ECO:0000269\|PubMed:9839469}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription repressor involved in regulation of protection against UV. Mediates transcriptional repression of CYP73A5, the gene encoding trans-cinnamate 4-monooxygenase, thereby regulating the accumulation of the UV-protectant compound sinapoylmalate. {ECO:0000269\|PubMed:11080161}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Prupe.1G323400.1.p

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Down-regulated by exposure to UV-B light. {ECO:0000269\|PubMed:11080161}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KT159234	0.0	KT159234.1 Prunus persica R2R3-MYB transcription factor (MYB18) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_021824312.1	1e-152	transcription repressor MYB4-like
Swissprot	Q9SZP1	9e-76	MYB4_ARATH; Transcription repressor MYB4
TrEMBL	M5Y0B9	1e-171	M5Y0B9_PRUPE; R2R3-MYB transcription factor
STRING	EMJ25070	1e-172	(Prunus persica)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF264	34	221

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G38620.1	4e-78	myb domain protein 4

Link Out ? help Back to Top
Phytozome	Prupe.1G323400.1.p
Entrez Gene	18793817

Publications ? help Back to Top
Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Schenke D,Cai D,Scheel D Suppression of UV-B stress responses by flg22 is regulated at the chromatin level via histone modification. Plant Cell Environ., 2014. 37(7): p. 1716-21 [PMID:24450952] Zhou M, et al. Changing a conserved amino acid in R2R3-MYB transcription repressors results in cytoplasmic accumulation and abolishes their repressive activity in Arabidopsis. Plant J., 2015. 84(2): p. 395-403 [PMID:26332741] Zhang J, et al. Soybean SPX1 is an important component of the response to phosphate deficiency for phosphorus homeostasis. Plant Sci., 2016. 248: p. 82-91 [PMID:27181950] Zhou M, et al. LNK1 and LNK2 Corepressors Interact with the MYB3 Transcription Factor in Phenylpropanoid Biosynthesis. Plant Physiol., 2017. 174(3): p. 1348-1358 [PMID:28483877] Mondal SK,Roy S Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis. J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601 [PMID:28490275] Verma N,Burma PK Regulation of tapetum-specific A9 promoter by transcription factors AtMYB80, AtMYB1 and AtMYB4 in Arabidopsis thaliana and Nicotiana tabacum. Plant J., 2017. 92(3): p. 481-494 [PMID:28849604]