PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Prupe.1G427600.1.p

Common Name

PRUPE_ppa020874mg

Organism

Prunus persica

Taxonomic ID

3760

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus

Family

M-type_MADS

Protein Properties

Length: 81aa MW: 9221.81 Da PI: 10.8372

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Prupe.1G427600.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	85.8	2.6e-27	9	58	1	50
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50 krien++n qvtfskRr g++KKA+ELSvLCd++va+i+fs++g+l +s Prupe.1G427600.1.p 9 KRIENTTNIQVTFSKRRSGLIKKAYELSVLCDVDVALIMFSPSGRLSLFS 58 79********************************************8876 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	2.4E-33	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	27.544	1	61	IPR002100	Transcription factor, MADS-box
CDD	cd00265	3.25E-33	2	75	No hit	No description
PRINTS	PR00404	1.8E-25	3	23	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	2.22E-29	3	78	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	7.7E-25	10	55	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.8E-25	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.8E-25	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 81 aa Download sequence Send to blast
MRRVKLQIKR IENTTNIQVT FSKRRSGLIK KAYELSVLCD VDVALIMFSP SGRLSLFSGN 60 KSIEEILARY VNLPEHERGR *

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
6byy_A	7e-18	1	80	1	79	MEF2 CHIMERA
6byy_B	7e-18	1	80	1	79	MEF2 CHIMERA
6byy_C	7e-18	1	80	1	79	MEF2 CHIMERA
6byy_D	7e-18	1	80	1	79	MEF2 CHIMERA
6bz1_A	7e-18	1	80	1	79	MEF2 CHIMERA
6bz1_B	7e-18	1	80	1	79	MEF2 CHIMERA
6bz1_C	7e-18	1	80	1	79	MEF2 CHIMERA
6bz1_D	7e-18	1	80	1	79	MEF2 CHIMERA
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in pollen. {ECO:0000269\|PubMed:12949148}.

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor that forms heterodimers with the MADS-box proteins AGL30 and AGL65 and is involved in the regulation of pollen maturation at the late stages of pollen development and pollen tube growth. {ECO:0000269\|PubMed:19211705}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Prupe.1G427600.1.p

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_007224359.2	1e-51	agamous-like MADS-box protein AGL104
Swissprot	Q9LM46	9e-37	AG104_ARATH; Agamous-like MADS-box protein AGL104
TrEMBL	M5XV77	6e-51	M5XV77_PRUPE; Uncharacterized protein
STRING	EMJ25558	9e-52	(Prunus persica)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF13665	19	22

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G22130.1	4e-39	AGAMOUS-like 104

Link Out ? help Back to Top
Phytozome	Prupe.1G427600.1.p
Entrez Gene	18793006

Publications ? help Back to Top
Zhang S, et al. FERTILIZATION-INDEPENDENT SEED-Polycomb Repressive Complex 2 Plays a Dual Role in Regulating Type I MADS-Box Genes in Early Endosperm Development. Plant Physiol., 2018. 177(1): p. 285-299 [PMID:29523711]