PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Prupe.1G531500.1.p

Organism

Prunus persica

Taxonomic ID

3760

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus

Family

M-type_MADS

Protein Properties

Length: 73aa MW: 8289.94 Da PI: 10.9866

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Prupe.1G531500.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	79.6	2.2e-25	19	62	8	51
HHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 8 nrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 rqvtfskRr gi+KKA ELSvLC+ evav+ifs tgkl++yss Prupe.1G531500.1.p 19 ARQVTFSKRRRGIFKKAAELSVLCESEVAVVIFSATGKLFDYSS 62 79****************************************96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	26.773	4	64	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	5.23E-25	4	65	IPR002100	Transcription factor, MADS-box
SMART	SM00432	1.8E-32	4	63	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.7E-23	6	26	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	2.3E-22	19	60	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.7E-23	26	41	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	1.7E-23	41	62	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 73 aa Download sequence Send to blast
MVKMMREKIK IKKIDYLPAR QVTFSKRRRG IFKKAAELSV LCESEVAVVI FSATGKLFDY 60 SSSSFLTRNK VI*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5f28_A	4e-16	4	64	1	61	MEF2C
5f28_B	4e-16	4	64	1	61	MEF2C
5f28_C	4e-16	4	64	1	61	MEF2C
5f28_D	4e-16	4	64	1	61	MEF2C
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Ppe.19900	1e-106	fruit

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Widely expressed with highest levels in shoot tips and axillary buds. Also found in fully developed pedicels and flowers.

Functional Description ? help Back to Top
Source	Description
UniProt	Putative transcription factor that coordinates gene expression underlying the differentiation of the pedicel abscission zone. May also be involved in the maintenance of the inflorescence meristem state.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Prupe.1G531500.1.p

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	DQ863250	1e-103	DQ863250.1 Prunus persica dam4 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_008219272.1	4e-38	PREDICTED: MADS-box protein AGL24-like isoform X1
Swissprot	Q9FUY6	4e-27	JOIN_SOLLC; MADS-box protein JOINTLESS
TrEMBL	A0A251RH48	2e-43	A0A251RH48_PRUPE; Uncharacterized protein
STRING	EMJ25143	9e-38	(Prunus persica)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF119	33	360

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G24540.1	9e-24	AGAMOUS-like 24

Link Out ? help Back to Top
Phytozome	Prupe.1G531500.1.p

Publications ? help Back to Top
Nakano T,Kato H,Shima Y,Ito Y Apple SVP Family MADS-Box Proteins and the Tomato Pedicel Abscission Zone Regulator JOINTLESS have Similar Molecular Activities. Plant Cell Physiol., 2015. 56(6): p. 1097-106 [PMID:25746985]