![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Prupe.2G219500.2.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
|
||||||||
| Family | NF-YB | ||||||||
| Protein Properties | Length: 140aa MW: 15337.4 Da PI: 5.9554 | ||||||||
| Description | NF-YB family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NF-YB | 181.1 | 9.3e-57 | 31 | 126 | 1 | 96 |
NF-YB 1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyr 91
vreqdr+lPian+srimkk+lP+n+ki+kdak+tvqecvsefisfvtseasdkcq+ekrktingddllwa+atlGfedy+epl++yl++yr
Prupe.2G219500.2.p 31 VREQDRYLPIANISRIMKKALPQNGKIAKDAKDTVQECVSEFISFVTSEASDKCQKEKRKTINGDDLLWAMATLGFEDYIEPLRIYLARYR 121
69***************************************************************************************** PP
NF-YB 92 elege 96
ele
Prupe.2G219500.2.p 122 ELEVT 126
**975 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Gene3D | G3DSA:1.10.20.10 | 4.2E-53 | 29 | 128 | IPR009072 | Histone-fold |
| SuperFamily | SSF47113 | 1.27E-39 | 34 | 129 | IPR009072 | Histone-fold |
| Pfam | PF00808 | 9.4E-29 | 37 | 101 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
| PRINTS | PR00615 | 7.4E-21 | 65 | 83 | No hit | No description |
| PROSITE pattern | PS00685 | 0 | 68 | 84 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
| PRINTS | PR00615 | 7.4E-21 | 84 | 102 | No hit | No description |
| PRINTS | PR00615 | 7.4E-21 | 103 | 121 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
| GO:0046982 | Molecular Function | protein heterodimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 140 aa Download sequence Send to blast |
MAEAPTSPAG GSHESGGEQS PQGGGGGGSG VREQDRYLPI ANISRIMKKA LPQNGKIAKD 60 AKDTVQECVS EFISFVTSEA SDKCQKEKRK TINGDDLLWA MATLGFEDYI EPLRIYLARY 120 RELEVTKRSL VLFNIFFYL* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 4awl_B | 2e-48 | 32 | 122 | 4 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| 4csr_A | 2e-48 | 32 | 122 | 4 | 94 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA |
| Search in ModeBase | ||||||
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Ppe.10381 | 1e-130 | fruit| shoot | ||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | TISSUE SPECIFICITY: Ubiquitous. Predominantly expressed in leaves, flowers and siliques. {ECO:0000269|PubMed:11250072, ECO:0000269|PubMed:9662544}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Prupe.2G219500.2.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_007218496.1 | 2e-87 | nuclear transcription factor Y subunit B-1 isoform X1 | ||||
| Refseq | XP_008233378.1 | 1e-87 | PREDICTED: nuclear transcription factor Y subunit B-1-like isoform X1 | ||||
| Refseq | XP_008233379.1 | 1e-87 | PREDICTED: nuclear transcription factor Y subunit B-1-like isoform X2 | ||||
| Refseq | XP_020414107.1 | 2e-87 | nuclear transcription factor Y subunit B-1 isoform X2 | ||||
| Refseq | XP_021819175.1 | 1e-87 | nuclear transcription factor Y subunit B-1-like isoform X1 | ||||
| Refseq | XP_021819176.1 | 1e-87 | nuclear transcription factor Y subunit B-1-like isoform X2 | ||||
| Swissprot | Q9SLG0 | 4e-67 | NFYB1_ARATH; Nuclear transcription factor Y subunit B-1 | ||||
| TrEMBL | A0A251QJX6 | 5e-99 | A0A251QJX6_PRUPE; Uncharacterized protein | ||||
| STRING | XP_008233378.1 | 5e-87 | (Prunus mume) | ||||
| STRING | EMJ19695 | 6e-87 | (Prunus persica) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G38880.3 | 2e-66 | nuclear factor Y, subunit B1 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Prupe.2G219500.2.p |




