PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Prupe.2G329200.3.p

Common Name

PRUPE_ppa022199mg

Organism

Prunus persica

Taxonomic ID

3760

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus

Family

GRF

Protein Properties

Length: 202aa MW: 22029.7 Da PI: 9.7617

Description

GRF family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Prupe.2G329200.3.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	WRC	79.6	3e-25	88	132	1	45
WRC 1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 d+epgrCrRtDGKkWRCs+++++++k+CErH+hrgr+rsrk++e+ Prupe.2G329200.3.p 88 DPEPGRCRRTDGKKWRCSKDAYPDSKYCERHMHRGRNRSRKPVES 132 79****************************************986 PP
2	QLQ	65.7	1.1e-22	26	62	1	37
QLQ 1 saFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37 s+FT +Q+q+L++Q+l++Ky++a++PvPp+L+++iqk Prupe.2G329200.3.p 26 SPFTVSQWQELEHQALIFKYMMAGMPVPPDLVLPIQK 62 89*********************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00951	3.7E-13	26	62	IPR014978	Glutamine-Leucine-Glutamine, QLQ
PROSITE profile	PS51666	24.576	27	62	IPR014978	Glutamine-Leucine-Glutamine, QLQ
Pfam	PF08880	1.3E-16	27	61	IPR014978	Glutamine-Leucine-Glutamine, QLQ
PROSITE profile	PS51667	25.762	88	132	IPR014977	WRC domain
Pfam	PF08879	1.8E-21	89	131	IPR014977	WRC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0005524	Molecular Function	ATP binding

Sequence ? help Back to Top
Protein Sequence Length: 202 aa Download sequence Send to blast
MNTCATGGGG GGGGGGGAAG MTGMRSPFTV SQWQELEHQA LIFKYMMAGM PVPPDLVLPI 60 QKSFESISQR FFHHPTMGYC SFYGKKVDPE PGRCRRTDGK KWRCSKDAYP DSKYCERHMH 120 RGRNRSRKPV ESQTMTQSSS TVTSLTVTAS SSGTGSFQNL PLNAFGNTQG TSSGTNQSHY 180 QIDSIPFGIP NKDYRYWGSC R*

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in stems (PubMed:27107174). Expressed in panicles (PubMed:26187814, PubMed:27250747, PubMed:27250749, PubMed:27107174). {ECO:0000269\|PubMed:26187814, ECO:0000269\|PubMed:27107174, ECO:0000269\|PubMed:27250747, ECO:0000269\|PubMed:27250749}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that plays a role in the regulation of meristematic function in leaves, stems and inflorescences (PubMed:24532604). Transcription activator that plays a regulatory role in grain development (PubMed:26187814, PubMed:27250747, PubMed:27250749, PubMed:26936408, PubMed:27107174). Positively regulates grain size by promoting cell division and expansion, leading to increased grain length and width (PubMed:26187814, PubMed:27250747, PubMed:27250749, PubMed:26936408, PubMed:27107174). Positively regulates the expression of genes promoting cell proliferation (PubMed:26187814, PubMed:26936408). Activates the expression of expansin genes to promote cell expansion and grain size (PubMed:27250747). May promote grain size by activating brassinosteroid responses (PubMed:27250747). Component of a network formed by the microRNA396 (miRNA396), the GRFs and their interacting factors (GIFs) acting in the regulation of meristem function, at least partially through the control of cell proliferation (Probable). Component of the miRNA396c-GRF4-GIF1 regulatory module that plays an important role in grain size determination (Probable) (PubMed:27250747, PubMed:27250749, PubMed:27107174). {ECO:0000269\|PubMed:24532604, ECO:0000269\|PubMed:26187814, ECO:0000269\|PubMed:26936408, ECO:0000269\|PubMed:27107174, ECO:0000269\|PubMed:27250747, ECO:0000269\|PubMed:27250749, ECO:0000305\|PubMed:26187814, ECO:0000305\|PubMed:27107174, ECO:0000305\|PubMed:27250747, ECO:0000305\|PubMed:27250749}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Prupe.2G329200.3.p

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: The microRNA396c negatively regulates GRF4 at the transcriptional level. {ECO:0000269\|PubMed:26187814, ECO:0000269\|PubMed:26936408, ECO:0000269\|PubMed:27107174, ECO:0000269\|PubMed:27250747}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020413149.1	1e-145	growth-regulating factor 4 isoform X2
Swissprot	Q6ZIK5	3e-61	GRF4_ORYSJ; Growth-regulating factor 4
TrEMBL	A0A251QTH8	1e-149	A0A251QTH8_PRUPE; Uncharacterized protein
STRING	EMJ20688	1e-144	(Prunus persica)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G13960.1	9e-47	growth-regulating factor 5

Link Out ? help Back to Top
Phytozome	Prupe.2G329200.3.p
Entrez Gene	18786937

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Kuijt SJ, et al. Interaction between the GROWTH-REGULATING FACTOR and KNOTTED1-LIKE HOMEOBOX families of transcription factors. Plant Physiol., 2014. 164(4): p. 1952-66 [PMID:24532604] Hu J, et al. A Rare Allele of GS2 Enhances Grain Size and Grain Yield in Rice. Mol Plant, 2015. 8(10): p. 1455-65 [PMID:26187814] Sun P, et al. OsGRF4 controls grain shape, panicle length and seed shattering in rice. J Integr Plant Biol, 2016. 58(10): p. 836-847 [PMID:26936408] Li S, et al. The OsmiR396c-OsGRF4-OsGIF1 regulatory module determines grain size and yield in rice. Plant Biotechnol. J., 2016. 14(11): p. 2134-2146 [PMID:27107174] Che R, et al. Control of grain size and rice yield by GL2-mediated brassinosteroid responses. Nat Plants, 2015. 2: p. 15195 [PMID:27250747] Duan P, et al. Regulation of OsGRF4 by OsmiR396 controls grain size and yield in rice. Nat Plants, 2015. 2: p. 15203 [PMID:27250749]