PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Prupe.3G267900.1.p

Common Name

PRUPE_ppa013998mg

Organism

Prunus persica

Taxonomic ID

3760

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus

Family

ZF-HD

Protein Properties

Length: 93aa MW: 9876.99 Da PI: 8.0522

Description

ZF-HD family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Prupe.3G267900.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	ZF-HD_dimer	105.3	3.7e-33	23	80	2	59
ZF-HD_dimer 2 ekvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 ++vrY eC+kNhAa +Gg+avDGC+Efm+s+geegt+aal+CaACgCHRnFHRreve+ Prupe.3G267900.1.p 23 RSVRYGECQKNHAAGVGGYAVDGCREFMASNGEEGTTAALTCAACGCHRNFHRREVET 80 579****************************************************875 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
ProDom	PD125774	2.0E-20	1	87	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Pfam	PF04770	8.5E-30	25	78	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMs	TIGR01566	4.2E-28	26	78	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profile	PS51523	24.958	27	77	IPR006456	ZF-HD homeobox protein, Cys/His-rich dimerisation domain

Sequence ? help Back to Top
Protein Sequence Length: 93 aa Download sequence Send to blast
MRKRQVVVRR SEEGSATSSF TMRSVRYGEC QKNHAAGVGG YAVDGCREFM ASNGEEGTTA 60 ALTCAACGCH RNFHRREVET VCECPSPSAN GA*

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Ppe.3478	1e-158	fruit

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Mostly expressed in stems, flowers and siliques, and, to a lower extent, in inflorescence. {ECO:0000269\|PubMed:16412086}.

Functional Description ? help Back to Top
Source	Description
UniProt	Inhibits zinc finger homeodomain (ZHD) transcription factors by interacting with them to prevent both their nuclear localization and their DNA-binding properties. Involved in integrating signals from multiple hormones by regulating the expression of specific genes. {ECO:0000269\|PubMed:21455630}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Prupe.3G267900.1.p

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_007215197.1	2e-61	mini zinc finger protein 2
Refseq	XP_008230765.1	2e-61	PREDICTED: mini zinc finger protein 2
Refseq	XP_021818945.1	2e-61	mini zinc finger protein 2-like
Swissprot	Q9LJW5	3e-41	MIF2_ARATH; Mini zinc finger protein 2
TrEMBL	A0A314UQ09	5e-60	A0A314UQ09_PRUYE; Mini zinc finger protein 2
TrEMBL	M5WT34	5e-60	M5WT34_PRUPE; Uncharacterized protein
STRING	XP_008230765.1	8e-61	(Prunus mume)
STRING	EMJ16396	8e-61	(Prunus persica)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF1550	34	100

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G28917.1	1e-29	mini zinc finger 2

Link Out ? help Back to Top
Phytozome	Prupe.3G267900.1.p
Entrez Gene	18782381

Publications ? help Back to Top
Bollier N, et al. At-MINI ZINC FINGER2 and Sl-INHIBITOR OF MERISTEM ACTIVITY, a Conserved Missing Link in the Regulation of Floral Meristem Termination in Arabidopsis and Tomato. Plant Cell, 2018. 30(1): p. 83-100 [PMID:29298836]