![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Prupe.4G177200.1.p | ||||||||
| Common Name | PRUPE_ppa022739mg | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
|
||||||||
| Family | SBP | ||||||||
| Protein Properties | Length: 163aa MW: 18482.6 Da PI: 9.1289 | ||||||||
| Description | SBP family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SBP | 132.8 | 1.2e-41 | 65 | 141 | 1 | 77 |
--SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
SBP 1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77
+Cq+e+C ad+ eak+y+rrhkvCe+hskapvv+vsgl+qrfCqqCsrfhel+efDe+krsCrrrLa+hnerrrk++
Prupe.4G177200.1.p 65 CCQAERCGADFVEAKRYYRRHKVCEFHSKAPVVMVSGLRQRFCQQCSRFHELTEFDEAKRSCRRRLAGHNERRRKSS 141
6**************************************************************************87 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PIRSF | PIRSF037575 | 2.0E-60 | 2 | 152 | IPR017238 | Squamosa promoter-binding protein |
| Gene3D | G3DSA:4.10.1100.10 | 1.6E-34 | 58 | 127 | IPR004333 | Transcription factor, SBP-box |
| PROSITE profile | PS51141 | 31.889 | 63 | 140 | IPR004333 | Transcription factor, SBP-box |
| SuperFamily | SSF103612 | 1.29E-38 | 63 | 143 | IPR004333 | Transcription factor, SBP-box |
| Pfam | PF03110 | 1.0E-31 | 66 | 139 | IPR004333 | Transcription factor, SBP-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0009908 | Biological Process | flower development | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0046872 | Molecular Function | metal ion binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 163 aa Download sequence Send to blast |
MEAKSFEGRQ SWKEKVNKDV VDEVEDDSEE EESGGGLMLR FEENEKQKKA GRRGSGGGGG 60 VSPPCCQAER CGADFVEAKR YYRRHKVCEF HSKAPVVMVS GLRQRFCQQC SRFHELTEFD 120 EAKRSCRRRL AGHNERRRKS SGEPYGEGSS RRGVASKQFQ IR* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1ul4_A | 3e-37 | 54 | 139 | 1 | 84 | squamosa promoter binding protein-like 4 |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: Increases during floral transition and stay high thereafter. {ECO:0000269|PubMed:10524240, ECO:0000269|PubMed:14573523}. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in the rib meristem and inter-primordial tissue of the inflorescence apex. {ECO:0000269|PubMed:10524240}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Probable transcriptional factor. Binds to the promoter of the SQUAMOSA gene. | |||||
| UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3' of AP1 promoter. Promotes both vegetative phase change and flowering. {ECO:0000269|PubMed:10524240, ECO:0000269|PubMed:16914499}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Prupe.4G177200.1.p |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Negatively regulated by microRNAs miR156 and miR157. {ECO:0000305|PubMed:12202040, ECO:0000305|PubMed:16914499}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_007213489.1 | 1e-114 | squamosa promoter-binding-like protein 3 | ||||
| Swissprot | Q38740 | 3e-44 | SBP2_ANTMA; Squamosa promoter-binding protein 2 | ||||
| Swissprot | Q9S7A9 | 3e-44 | SPL4_ARATH; Squamosa promoter-binding-like protein 4 | ||||
| TrEMBL | M5WZC7 | 1e-112 | M5WZC7_PRUPE; Squamosa promoter-binding-like protein | ||||
| STRING | EMJ14688 | 1e-113 | (Prunus persica) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF535 | 34 | 153 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT3G15270.1 | 2e-45 | squamosa promoter binding protein-like 5 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Prupe.4G177200.1.p |
| Entrez Gene | 18778559 |




