![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Prupe.6G199000.5.p | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
|
||||||||
| Family | MIKC_MADS | ||||||||
| Protein Properties | Length: 229aa MW: 25739.1 Da PI: 5.8572 | ||||||||
| Description | MIKC_MADS family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | SRF-TF | 89.6 | 1.6e-28 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
k+i+n + rqvtfskRr g++KKA+ELSvLCda++a+iifsstgkl+ey+s
Prupe.6G199000.5.p 9 KKIDNATARQVTFSKRRRGLFKKAQELSVLCDADIALIIFSSTGKLFEYAS 59
68***********************************************86 PP
| |||||||
| 2 | K-box | 46.7 | 1.4e-16 | 92 | 171 | 19 | 98 |
K-box 19 qelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkkl 98
+++ L kei +++R++ Ge+++ L+l+eLqqLe+ Le +l ++ +kK e ++++i++l +l een++Lr+++
Prupe.6G199000.5.p 92 SNYSALSKEITAQSQQLRQIRGEEIQGLNLEELQQLEKSLEAGLGRVIEKKGEKIMKEISDLESNAMRLVEENERLRQQV 171
57889999999999****************************************************************98 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS50066 | 30.656 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
| SMART | SM00432 | 1.9E-40 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
| CDD | cd00265 | 1.58E-39 | 2 | 69 | No hit | No description |
| SuperFamily | SSF55455 | 2.22E-31 | 3 | 72 | IPR002100 | Transcription factor, MADS-box |
| PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 6.5E-28 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
| Pfam | PF00319 | 1.9E-25 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 6.5E-28 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
| PRINTS | PR00404 | 6.5E-28 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
| PROSITE profile | PS51297 | 12.511 | 87 | 177 | IPR002487 | Transcription factor, K-box |
| Pfam | PF01486 | 2.2E-15 | 92 | 171 | IPR002487 | Transcription factor, K-box |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0009266 | Biological Process | response to temperature stimulus | ||||
| GO:0009910 | Biological Process | negative regulation of flower development | ||||
| GO:0010076 | Biological Process | maintenance of floral meristem identity | ||||
| GO:0010582 | Biological Process | floral meristem determinacy | ||||
| GO:0030154 | Biological Process | cell differentiation | ||||
| GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
| GO:0048438 | Biological Process | floral whorl development | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0000900 | Molecular Function | translation repressor activity, nucleic acid binding | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
| GO:0046983 | Molecular Function | protein dimerization activity | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 229 aa Download sequence Send to blast |
MAREKIQIKK IDNATARQVT FSKRRRGLFK KAQELSVLCD ADIALIIFSS TGKLFEYASS 60 SMKEILERHN LHAKNLSKIE QPSLELQLVE NSNYSALSKE ITAQSQQLRQ IRGEEIQGLN 120 LEELQQLEKS LEAGLGRVIE KKGEKIMKEI SDLESNAMRL VEENERLRQQ VLEKHNSQKP 180 VRADSENIVM EEGQSSESVT TNLCNSNSAP QDYESSDTSL KLGLPYSG* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 5f28_A | 2e-22 | 1 | 69 | 1 | 69 | MEF2C |
| 5f28_B | 2e-22 | 1 | 69 | 1 | 69 | MEF2C |
| 5f28_C | 2e-22 | 1 | 69 | 1 | 69 | MEF2C |
| 5f28_D | 2e-22 | 1 | 69 | 1 | 69 | MEF2C |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: During vegetative phase expressed in young leaves and apical meristem until early stage of bolting. Early in development of the inflorescence present in the coflorescence and flower primordia but not in the main apical meristem. Present throughout the floral meristem during early stages of flower development. Later disappears prior to emergence of sepal primordia. {ECO:0000269|PubMed:19656343}. | |||||
| Uniprot | TISSUE SPECIFICITY: Detected in roots and leaves. Expressed at very low levels in flowers and siliques. Present in floral meristems. {ECO:0000269|PubMed:19656343}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription repressor that inhibit floral transition in the autonomous flowering pathway, independent of photoperiod and temperature. Acts in a dosage-dependent manner. Together with AGL24 and AP1, controls the identity of the floral meristem and regulates expression of class B, C and E genes. Promotes EFM expression to suppress flowering (PubMed:25132385). {ECO:0000269|PubMed:16679456, ECO:0000269|PubMed:18694458, ECO:0000269|PubMed:19656343, ECO:0000269|PubMed:25132385}. | |||||
| Binding Motif ? help Back to Top | |||
|---|---|---|---|
| Motif ID | Method | Source | Motif file |
| MP00272 | DAP | Transfer from AT2G22540 | Download |
| |||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Prupe.6G199000.5.p |
| Regulation -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | INDUCTION: Repressed by the floral homeotic genes AP1 and SEP3 in emerging floral meristems. Up-regulated by HUA2. {ECO:0000269|PubMed:15659097, ECO:0000269|PubMed:17428825, ECO:0000269|PubMed:18694458}. | |||||
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | Retrieve | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | KT803845 | 0.0 | KT803845.1 Prunus mume SVP-like protein 1 mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_020422314.1 | 1e-164 | MADS-box protein SVP isoform X1 | ||||
| Swissprot | Q9FVC1 | 1e-107 | SVP_ARATH; MADS-box protein SVP | ||||
| TrEMBL | A0A251NT68 | 1e-162 | A0A251NT68_PRUPE; Uncharacterized protein | ||||
| STRING | XP_008235579.1 | 1e-161 | (Prunus mume) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT2G22540.1 | 3e-87 | MIKC_MADS family protein | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Prupe.6G199000.5.p |




