![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Prupe.6G239600.1.p | ||||||||
| Common Name | PRUPE_ppa014157mg | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
|
||||||||
| Family | S1Fa-like | ||||||||
| Protein Properties | Length: 84aa MW: 9043.79 Da PI: 10.5229 | ||||||||
| Description | S1Fa-like family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | S1FA | 127.4 | 4.3e-40 | 17 | 83 | 4 | 70 |
S1FA 4 akveakGlnPGlivllvvgglllvflvgnyilyvyaqknlPPrkkkPvskkklkreklkqGvavPGe 70
+ + akG+nPGlivllvv gll++flvgny+lyvyaq+++PP+kkkPvskkklkre+lkqGv++PGe
Prupe.6G239600.1.p 17 GVAAAKGFNPGLIVLLVVVGLLVIFLVGNYALYVYAQRTVPPKKKKPVSKKKLKRERLKQGVSAPGE 83
66789*************************************************************8 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| Pfam | PF04689 | 9.5E-38 | 20 | 83 | IPR006779 | DNA binding protein S1FA |
| ProDom | PD019013 | 0.006 | 22 | 83 | No hit | No description |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0005634 | Cellular Component | nucleus | ||||
| GO:0016021 | Cellular Component | integral component of membrane | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 84 aa Download sequence Send to blast |
MADEFEFADK VPPSFDGVAA AKGFNPGLIV LLVVVGLLVI FLVGNYALYV YAQRTVPPKK 60 KKPVSKKKLK RERLKQGVSA PGE* |
| Expression -- UniGene ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| UniGene ID | E-value | Expressed in | ||||
| Ppe.20125 | 1e-140 | fruit | ||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | DNA-binding protein that specifically recognizes a negative element (S1F) within the RPS1 promoter. {ECO:0000250}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Prupe.6G239600.1.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_007207530.1 | 4e-52 | DNA-binding protein S1FA | ||||
| Refseq | XP_008239342.1 | 4e-52 | PREDICTED: DNA-binding protein S1FA-like | ||||
| Refseq | XP_021806782.1 | 4e-52 | DNA-binding protein S1FA-like | ||||
| Swissprot | P42553 | 8e-15 | S1FA1_ORYSJ; DNA-binding protein S1FA1 | ||||
| TrEMBL | A0A314ZQY6 | 9e-51 | A0A314ZQY6_PRUYE; DNA-binding protein S1FA | ||||
| TrEMBL | M5W4V1 | 9e-51 | M5W4V1_PRUPE; Uncharacterized protein | ||||
| STRING | XP_008239342.1 | 2e-51 | (Prunus mume) | ||||
| STRING | EMJ08729 | 2e-51 | (Prunus persica) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF5409 | 33 | 55 |
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Prupe.6G239600.1.p |
| Entrez Gene | 18771964 |




