![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Prupe.6G270000.1.p | ||||||||
| Common Name | PRUPE_ppa021145mg | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
|
||||||||
| Family | MYB_related | ||||||||
| Protein Properties | Length: 93aa MW: 10646.5 Da PI: 9.9793 | ||||||||
| Description | MYB_related family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | Myb_DNA-binding | 59.4 | 8e-19 | 14 | 61 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
+g+WT+eEd++l+d+++ +G+g+W++ ++ g+ R++k+c++rw +yl
Prupe.6G270000.1.p 14 KGAWTKEEDQRLIDYIRVHGKGCWRSLPKAAGLLRCGKSCRLRWINYL 61
79******************************99************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51294 | 23.222 | 9 | 65 | IPR017930 | Myb domain |
| SMART | SM00717 | 1.2E-13 | 13 | 63 | IPR001005 | SANT/Myb domain |
| Gene3D | G3DSA:1.10.10.60 | 2.6E-21 | 13 | 60 | IPR009057 | Homeodomain-like |
| Pfam | PF00249 | 8.4E-17 | 14 | 61 | IPR001005 | SANT/Myb domain |
| SuperFamily | SSF46689 | 3.27E-23 | 15 | 87 | IPR009057 | Homeodomain-like |
| CDD | cd00167 | 1.44E-10 | 16 | 61 | No hit | No description |
| Gene3D | G3DSA:1.10.10.60 | 7.7E-10 | 61 | 87 | IPR009057 | Homeodomain-like |
| PROSITE profile | PS51294 | 9.336 | 66 | 92 | IPR017930 | Myb domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 93 aa Download sequence Send to blast |
MGRSPCCEKV HTNKGAWTKE EDQRLIDYIR VHGKGCWRSL PKAAGLLRCG KSCRLRWINY 60 LRPDLKRGNF TEEEDELIIK LHSLLGKAPL KL* |
| 3D Structure ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
| 1h8a_C | 3e-17 | 13 | 86 | 26 | 98 | MYB TRANSFORMING PROTEIN |
| Search in ModeBase | ||||||
| Expression -- Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| Uniprot | DEVELOPMENTAL STAGE: Expression in flowers increases as the flowers develop. {ECO:0000269|PubMed:1840903}. | |||||
| Uniprot | TISSUE SPECIFICITY: Expressed in flowers and weakly in roots and stems. {ECO:0000269|PubMed:1840903}. | |||||
| Functional Description ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Description | |||||
| UniProt | Transcription factor. {ECO:0000305}. | |||||
| Cis-element ? help Back to Top | |
|---|---|
| Source | Link |
| PlantRegMap | Prupe.6G270000.1.p |
| Regulation -- PlantRegMap ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Upstream Regulator | Target Gene | ||||
| PlantRegMap | Retrieve | - | ||||
| Annotation -- Nucleotide ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | |||
| GenBank | KT159236 | 1e-138 | KT159236.1 Prunus persica R2R3-MYB transcription factor (MYB20) mRNA, complete cds. | |||
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_022727844.1 | 2e-57 | transcription repressor MYB6-like isoform X1 | ||||
| Swissprot | P81395 | 3e-55 | MYB30_ANTMA; Myb-related protein 330 | ||||
| TrEMBL | A0A251NZU3 | 6e-61 | A0A251NZU3_PRUPE; Uncharacterized protein | ||||
| STRING | XP_008219033.1 | 1e-55 | (Prunus mume) | ||||
| STRING | EMJ09816 | 3e-58 | (Prunus persica) | ||||
| STRING | cassava4.1_032831m | 3e-56 | (Manihot esculenta) | ||||
| Orthologous Group ? help Back to Top | |||
|---|---|---|---|
| Lineage | Orthologous Group ID | Taxa Number | Gene Number |
| Fabids | OGEF31 | 34 | 817 |
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT4G09460.1 | 5e-57 | myb domain protein 6 | ||||
| Link Out ? help Back to Top | |
|---|---|
| Phytozome | Prupe.6G270000.1.p |
| Entrez Gene | 18772476 |
| Publications ? help Back to Top | |||
|---|---|---|---|
|
|||




