PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Psi003868

Organism

Picea sitchensis

Taxonomic ID

3332

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea

Family

MYB

Protein Properties

Length: 243aa MW: 27591.9 Da PI: 9.044

Description

MYB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
gnl\|UG\|Psi#S41648126	PU_unref	Unigene	View CDS
PUT-183a-Picea_sitchensis-2782	PU_ref	plantGDB	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	53.1	7.3e-17	15	62	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g+WT+eEde+l+ ++ +G g+W++ ++ g+ R++k+c++rw +yl Psi003868 15 KGAWTKEEDERLIAHIEAHGEGSWRSLPKAAGLLRCGKSCRLRWINYL 62 79****************************99**********97 PP
2	Myb_DNA-binding	54	3.8e-17	68	113	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 rg+ ++eEd+l+++++ +lG++ W++Ia +++ gRt++++k++w++++ Psi003868 68 RGSISEEEDDLIIKLHSLLGNR-WSLIAGRLP-GRTDNEIKNYWNTHM 113 7888****************.*****.**********986 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	14.353	10	62	IPR017930	Myb domain
SuperFamily	SSF46689	1.76E-29	14	109	IPR009057	Homeodomain-like
SMART	SM00717	3.8E-13	14	64	IPR001005	SANT/Myb domain
Pfam	PF00249	6.7E-15	15	62	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	2.2E-22	16	69	IPR009057	Homeodomain-like
CDD	cd00167	6.24E-10	17	62	No hit	No description
PROSITE profile	PS51294	27.742	63	117	IPR017930	Myb domain
SMART	SM00717	8.4E-17	67	115	IPR001005	SANT/Myb domain
Pfam	PF00249	1.7E-15	68	112	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	6.2E-27	70	117	IPR009057	Homeodomain-like
CDD	cd00167	1.12E-11	72	113	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 243 aa Download sequence Send to blast
MGRSPCCEKV HANNKGAWTK EEDERLIAHI EAHGEGSWRS LPKAAGLLRC GKSCRLRWIN 60 YLRPDLKRGS ISEEEDDLII KLHSLLGNRW SLIAGRLPGR TDNEIKNYWN THMKKKLLSR 120 GLDPQSHRPL GQPCKTTLSS RPIPEHEIRG FQSPRTAEVA DFFHYDRQES SAFKRAASDA 180 EERPDLNLDL XHLTLAVNLS SQITVKLRGQ ICRKDSSSNI KLPEEAYSSS SSISVDKEFD 240 FAR

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1h8a_C	6e-31	14	117	26	128	MYB TRANSFORMING PROTEIN
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Psi.5763	0.0	shoot

Expression -- Description ? help Back to Top
Source	Description
Uniprot	DEVELOPMENTAL STAGE: Expression in flowers increases as the flowers develop. {ECO:0000269\|PubMed:1840903}.
Uniprot	TISSUE SPECIFICITY: Expressed in roots, stems, leaves, seed pods and flowers. {ECO:0000269\|PubMed:1840903}.
Uniprot	TISSUE SPECIFICITY: Widely expressed at low level. Highly expressed in siliques. Weakly expressed in seedlings, young and mature leaves, cauline leaves, stems, flower buds and roots. {ECO:0000269\|PubMed:9839469}.

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor. {ECO:0000305}.
UniProt	Transcription repressor involved in regulation of protection against UV. Mediates transcriptional repression of CYP73A5, the gene encoding trans-cinnamate 4-monooxygenase, thereby regulating the accumulation of the UV-protectant compound sinapoylmalate. {ECO:0000269\|PubMed:11080161}.

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Down-regulated by exposure to UV-B light. {ECO:0000269\|PubMed:11080161}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_010028718.1	3e-87	PREDICTED: myb-related protein 308
Swissprot	P81393	2e-80	MYB08_ANTMA; Myb-related protein 308
Swissprot	Q9SZP1	3e-80	MYB4_ARATH; Transcription repressor MYB4
TrEMBL	A9NY74	1e-138	A9NY74_PICSI; Uncharacterized protein
STRING	XP_010028718.1	1e-86	(Eucalyptus grandis)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G38620.1	2e-82	myb domain protein 4

Publications ? help Back to Top
Jackson D,Culianez-Macia F,Prescott AG,Roberts K,Martin C Expression patterns of myb genes from Antirrhinum flowers. Plant Cell, 1991. 3(2): p. 115-25 [PMID:1840903] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Schenke D,Cai D,Scheel D Suppression of UV-B stress responses by flg22 is regulated at the chromatin level via histone modification. Plant Cell Environ., 2014. 37(7): p. 1716-21 [PMID:24450952] Zhou M, et al. Changing a conserved amino acid in R2R3-MYB transcription repressors results in cytoplasmic accumulation and abolishes their repressive activity in Arabidopsis. Plant J., 2015. 84(2): p. 395-403 [PMID:26332741] Zhang J, et al. Soybean SPX1 is an important component of the response to phosphate deficiency for phosphorus homeostasis. Plant Sci., 2016. 248: p. 82-91 [PMID:27181950] Zhou M, et al. LNK1 and LNK2 Corepressors Interact with the MYB3 Transcription Factor in Phenylpropanoid Biosynthesis. Plant Physiol., 2017. 174(3): p. 1348-1358 [PMID:28483877] Mondal SK,Roy S Genome-wide sequential, evolutionary, organizational and expression analyses of phenylpropanoid biosynthesis associated MYB domain transcription factors in Arabidopsis. J. Biomol. Struct. Dyn., 2018. 36(6): p. 1577-1601 [PMID:28490275] Verma N,Burma PK Regulation of tapetum-specific A9 promoter by transcription factors AtMYB80, AtMYB1 and AtMYB4 in Arabidopsis thaliana and Nicotiana tabacum. Plant J., 2017. 92(3): p. 481-494 [PMID:28849604]